Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
---|---|---|---|---|---|---|---|---|
CancerPDF_ID8612 | DEAGSEADHEGTHSTKRGHAKSRPV | Isoform 2 of fibrinogen (FGA) chain precursor | Serum | 2660.11 | MALDI-TOF | Breast cancer | Upregulated in cancer as compare to normal control with fold change of 1.5 | 26705257 |
CancerPDF_ID8613 | SEMVVAGKLQ | Inter- trypsin inhibitor heavy chain H4 (ITIH4) precursor | Serum | 1061.09 | MALDI-TOF | Breast cancer | Upregulated in cancer as compare to normal control with fold change of 1.6 | 26705257 |
CancerPDF_ID8614 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter- trypsin inhibitor heavy chain H4 (ITIH4) fragment | Serum | 3273.69 | MALDI-TOF | Breast cancer | Upregulated in cancer as compare to normal control with fold change of 1.7 | 26705257 |
CancerPDF_ID8615 | IAQDLEMYGINYFEIK | EZR (Ezrin fragment) | Serum | 1945.33 | MALDI-TOF | Breast cancer | Upregulated in cancer as compare to normal control with fold change of 1.8 | 26705257 |
CancerPDF_ID8616 | HNLGHGHKHERDQGHGHQ | Isoform HMW of kininogen-1 (KNG1) precursor | Serum | 2082.04 | MALDI-TOF | Breast cancer | Upregulated in cancer as compare to normal control with fold change of 1.9 | 26705257 |
CancerPDF_ID8617 | NVHSAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter- trypsin inhibitor heavy chain H4 (ITIH4) fragment | Serum | 4280.55 | MALDI-TOF | Breast cancer | Upregulated in cancer as compare to normal control with fold change of 1.10 | 26705257 |
CancerPDF_ID8618 | TPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS | Apolipoprotein C-I precursor | Serum | 6625.91 | MALDI-TOF | Breast cancer | Downregulated in cancer as compare to normal control with fold change of 1.5 | 26705257 |
CancerPDF_ID8619 | FLGDRDFNQFSSGEKNIFLASFVHEYSR | Fetoprotein (AFP) precursor | Serum | 3315.21 | MALDI-TOF | Breast cancer | Downregulated in cancer as compare to normal control with fold change of 1.6 | 26705257 |
CancerPDF_ID8620 | ARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ | Apolipoprotein A-I precursor | Serum | 6428.21 | MALDI-TOF | Breast cancer | Downregulated in cancer as compare to normal control with fold change of 1.7 | 26705257 |
CancerPDF_ID8621 | VELGTQPATQ | Apolipoprotein A-II precursor | Serum | 1041.25 | MALDI-TOF | Breast cancer | Downregulated in cancer as compare to normal control with fold change of 1.8 | 26705257 |