| Primary information |
|---|
| sequence ID | Seq_5819 |
| Peptide sequence | NVHSAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPF |
| CancerPDF_ID | CancerPDF_ID8617, |
| PMID | 26705257 |
| Protein Name | Inter- trypsin inhibitor heavy chain H4 (ITIH4) fragment |
| UniprotKB Entry Name | ITIH4_HUMAN |
| Fluid | Serum |
| M/Z | 4280.55 |
| Profiling Technique | MALDI-TOF |
| Peptide Identification technique | LC-ESI-MS/MS |
| Labelled/Label Free | Label Free |
| CancerPDF_ID | CancerPDF_ID8617, |
| p-Value | 1.00E-06 |
| Software | ClinProTools |
| Length | 41 |
| Cancer Type | Breast cancer |
| Database | Uniprot protein sequence Database |
| Modification | NA |
| Number of Patients | 96 Breast Cancer patients and 64 healthy controls |
| Regulation | Upregulated in cancer as compare to normal control with fold change of 1.10 |
| Validation | NA |
| Sensitivity | NA |
| Specificity | NA |
| Accuracy | NA |
| Peptide Atlas | NA |
| IEDB | NA |