Browse result page of AntiTbPdb
The total number entries retrieved from this search are 619
ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
antitb_1328 | 1-11mer | H-(NLys-Nspe-Nspe)3-NLys-Nspe-NH2 | Free | Amidation | Nlys = N-(4-aminobutyl)glycine, Nspe = (S)-N-(1-phenylethyl)glycine | Linear | 11 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium bovis BCG | MIC = 12.5-25 μM | In vitro | Raw 264.7 and J774 mouse macrophage | NA | LD50 = 50μM | NA | NA | NA | NA | NA | NA | NA | 2011 | 21464254 |
antitb_1329 | 1-Nssb | H-(NLys-Nssb-Nssb)4-NH2 | Free | Amidation | Nlys = N-(4-aminobutyl)glycine, Nssb = (S)-N-(sec-butyl)glycine | Linear | 12 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium bovis BCG | MIC = >100 μM | In vitro | Raw 264.7 and J774 mouse macrophage | NA | Non toxic | NA | NA | NA | NA | NA | NA | NA | 2011 | 21464254 |
antitb_1330 | Human beta casein fragment (54-59) | VEPIPY | Free | Free | None | Linear | 6 | L | Cationic | Protein derived | Human beta casein protein | Mycobacterium bovis | Mycobacterium bovis BCG | MIC = 25μM | in vitro | THP 1 cell lines | Cells treated with 10 mM and 20 mM peptide showed 17.13% and 29.56% increase in clearance of BCG | NA | NA | NA | Increase expression of IL-8, MCP-1, MIP-1β, TNF-α | NA | NA | NA | NA | 2012 | 23029305 |
antitb_1331 | Innate defence regulator peptide HH2 | VQLRIRVAVIRA | Free | Free | None | Linear | 12 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | NA | Both | Human U937 promonocytic cell line | NA | None | BALB/C | 32 mg in 100 mL of saline solution (1 mg/kg) | Increase expression of MCP-1,Gro-α and TNF-α | NA | NA | NA | Antimicrobial against plasmodium aeruginosa/ S. aureus | 2012 | 23555622 |
antitb_1332 | Innate defence regulator peptide 1002 | VQRWLIVWRIRK | Free | Free | None | Linear | 12 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 29.3 ± 11.8 mg/mL | Both | Human U937 promonocytic cell line | NA | None | BALB/C | 32 mg in 100 mL of saline solution (1 mg/kg) | Increase expression of MCP-1,Gro-α and TNF-α | NA | NA | NA | Antimicrobial against plasmodium aeruginosa/ S. aureus | 2012 | 23555622 |
antitb_1333 | Innate defence regulator peptide 1018 | VRLIVAVRIWRR | Free | Free | None | Linear | 12 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 16.4± 5.4 mg/mL | Both | Human U937 promonocytic cell line | NA | None | BALB/C | 32 mg in 100 mL of saline solution (1 mg/kg) | Increase expression of MCP-1,Gro-α and TNF-α | NA | NA | NA | Antimicrobial against plasmodium aeruginosa/ S. aureus | 2012 | 23555622 |
antitb_1353 | Peptide KSl | KKVVFKVKFK | Free | Free | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 607 | MIC = 6.25μg/ml | In vitro | Mouse erythrocyte | NA | None | NA | NA | NA | NA | NA | NA | antifungal, antibacterial against C.albicans | 1998 | 9756752 |
antitb_1370 | Human neutrophil peptides-1 | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | cyclic | 30 | L | Cationic | Synthetic | Human neutrophils | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37 Ra | NA | in vitro | None | NA | NA | NA | NA | NA | NA | Mycobacterial genomic DNA | NA | antibacterial against candida albicans | 2000 | 11375668 |
antitb_1371 | Mycobacterial tuberculosis DHFR tripeptide analog | WYD | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 1.26 × 10−7 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
antitb_1372 | Mycobacterial tuberculosis DHFR tripeptide analog | WYE | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 5.02 × 10−6 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
antitb_1373 | Mycobacterial tuberculosis DHFR tripeptide analog | WPD | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 9.12 × 10−9 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
antitb_1374 | Mycobacterial tuberculosis DHFR tripeptide analog | WPE | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 1.02 × 10−6 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
antitb_1375 | Mycobacterial tuberculosis DHFR tripeptide analog | YPD | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 4.17 × 10−8 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
antitb_1376 | Mycobacterial tuberculosis DHFR tripeptide analog | YPE | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 2.75 × 10−8 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
antitb_1377 | Mycobacterial tuberculosis DHFR tripeptide analog | WYY | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 1.78 × 10−9 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
antitb_1378 | Mycobacterial tuberculosis DHFR tripeptide analog | WPY | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 9.55 × 10−8 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
antitb_1379 | Mycobacterial tuberculosis DHFR tripeptide analog | WYP | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 4.57 × 10−8 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
antitb_1380 | Mycobacterial tuberculosis DHFR tripeptide analog | WPW | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 4.27 × 10−6 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
antitb_1381 | Mycobacterial tuberculosis DHFR tripeptide analog | WYW | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 1.45 × 10−7 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
antitb_1382 | Mycobacterial tuberculosis DHFR tripeptide analog | WYS | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 1.44 × 10−8 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
antitb_1383 | Mycobacterial tuberculosis DHFR tripeptide analog | WPS | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 7.94 × 10−8 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
antitb_1384 | Mycobacterial tuberculosis DHFR tripeptide analog | WPT | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 2.95 × 10−7 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
antitb_1385 | Mycobacterial tuberculosis DHFR tripeptide analog | WYT | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 3.31 × 10−6 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
antitb_1386 | Mycobacterial tuberculosis DHFR tripeptide analog | YPS | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 8.91 × 10−6 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
antitb_1387 | Mycobacterial tuberculosis DHFR tripeptide analog | YPT | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 6.46 × 10−6 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
antitb_1388 | Hepcidin | DTHFPICIFCCGCCHRSKCGMCCKT | Free | Free | Disulphide linkage between cys7-23, cys10-13, cys11-19,cys14-22 | Cyclic | 25 | L | Cationic | Natural | Human alveolar type 2 epithilium | Mycobacterium tuberculosis | Mycobacterium H37Rv | NA | in vivo | A549 cell line | NA | No cytotoxicity | BALB/C | NA | Increased production of TNF-α, IL-1α | NA | Mycobacterium tuberculosis + IFN-Υ | antimicrobial | 2011 | 21482189 | |
antitb_1389 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 1μg /ml | in vitro | J774.A1 macrophage cell lines | 14% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
antitb_1390 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 1μg /ml (after 6 hours) | in vitro | J774.A1 macrophage cell lines | 34% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
antitb_1391 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 25μg/ml | in vitro | J774.A1 macrophage cell lines | 41% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
antitb_1392 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 25μg /ml (after 6 hours incubation) | in vitro | J774.A1 macrophage cell lines | 67% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
antitb_1393 | GEK-31 | RKSKEKIGKEFKRIVQR IKDFLRNLVPRTES | Free | Free | None | Linear | 33 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | NA | in vitro | J774.A1 macrophage cell lines | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
antitb_1394 | LL-18 | KEFKRIVQRIKDFLRNLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | NA | in vitro | J774.A1 macrophage cell lines | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
antitb_1395 | LLKKK-18 | KEFKRIVKRIKKFLRKLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 1μg /ml | in vitro | J774.A1 macrophage cell lines | 67% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
antitb_1396 | LLKKK-18 | KEFKRIVKRIKKFLRKLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 1μg /ml (after 6 hours) | in vitro | J774.A1 macrophage cell lines | 89% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
antitb_1397 | LLKKK-18 | KEFKRIVKRIKKFLRKLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 25μg/ml | in vitro | J774.A1 macrophage cell lines | 81% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
antitb_1398 | LLKKK-18 | KEFKRIVKRIKKFLRKLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 25μg /ml (after 6 hours incubation) | in vitro | J774.A1 macrophage cell lines | 98% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
antitb_1399 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacteria bovis | Mycobacteria bovis BCG | MIC = 25μg/ml | in vitro | THP-1 cells | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
antitb_1400 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacteria bovis | Mycobacteria bovis BCG | MIC = 25μg /ml (after 624hours incubation) | in vitro | THP-1 cells | > 60% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
antitb_1401 | LLKKK-18 | KEFKRIVKRIKKFLRKLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 1μg /ml | in vitro | J774.A1 macrophage cell lines | 51% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
antitb_1402 | LLKKK-18 | KEFKRIVKRIKKFLRKLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 25μg/ml | in vitro | J774.A1 macrophage cell lines | 80% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
antitb_1403 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 25μg/ml (24 hours incubation) | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
antitb_1404 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 100 μg/mL (72 hours incubation) | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
antitb_1405 | D-LAK120 | KKLALLALKKWLLALKKLALLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis susceptible strain | NA | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
antitb_1406 | D-LAK120 | KKLALLALKKWLLALKKLALLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR strain | MIC = 50 μM | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
antitb_1407 | D-LAK120-P13 | KKLALLALKKWLPALKKLALLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR strain | MIC = 100 μM | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
antitb_1408 | D-LAK120-A | KKLALALAKKWLALAKKLALALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR strain | MIC = 25 μM | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
antitb_1409 | D-LAK120-HP13 | KKALAHALKKWLPALKKLAHALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR strain | MIC = 25 μM | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
antitb_1410 | D-LAK120-H | KKLALHALKKWLHALKKLAHLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR strain | NA | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
antitb_1411 | D-LAK120 | KKLALLALKKWLLALKKLALLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain | MIC = 50 μM | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
antitb_1412 | D-LAK120-P13 | KKLALLALKKWLPALKKLALLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain | MIC = 100 μM | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |