Browse result page of AntiTbPdb
The total number entries retrieved from this search are 452
| ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| antitb_1946 | Peptide-9 | GF(A6c)G(Oic)K(A6c)G(Oic)F(A6c)G(Oic)GK(Oic)KKKK | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, Oic = Octahydroindolecarboxylic acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR | MIC = 20.92 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1947 | Peptide-10 | GF(A5c)G(A6c)K(A5c)G(A6c)F(A5c)G(A6c)GK(A5c)KKKK | Acetylation | Amidation | A5c = 1-aminocyclopentane carboxylic acid, A6c 1-aminocyclohexane carboxylic acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR | MIC = 11.21 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1948 | Peptide-11 | KKKKGF(A6c)G(A6c)K(A6c)G(A6c)F(A6c)G(A6c)GK(A6c) | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR | MIC = 10.94 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1953 | Wollamide- B | WAlVNx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 80 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1954 | Wollamide- B | ALlVNx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 80 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1955 | Wollamide- B | WLlVAx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 20 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1956 | Wollamide- B | WLlANx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 80 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1957 | Wollamide- B | WLaVNx | Free | Free | Third residue is D-alanine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 80 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1958 | Wollamide- B | WLlINx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 1.1 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 50 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1959 | Wollamide- B | WLlMNx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 80 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1960 | Wollamide- B | WLlVxx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC =2.5 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 50 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1961 | Wollamide- B | WLlISx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC =15 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1962 | Wollamide- B | WLlIXx | Free | Free | Third residue is D-leucine, fifth residue is tertiary butyl serine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 40 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1963 | Wollamide- B | WLlIIx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 3.1 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1964 | Wollamide- B | WLlINr | Free | Free | Third residue is D-leucine and r= D- arginine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 0.6 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1965 | Wollamide- B | xLlVNx | Free | Free | First residue is D- phenyalanine, Third is D-leucine and sixth is D-ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 40 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1974 | KSL | KKVVFKVKFK | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 607 | MIC=6.25µg/ml | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA | Candida albicans, Shigella flexneri, Proteus vulgaris, Pseudomonas aeruginosa, Escherichia coli, Micrococcus luteus, Staphylococcus epidermidis, MRSA, Staphylococcus aureus | 1998 | 9756752 |
| antitb_1975 | KSL1 | KKVVVKVKFK | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 608 | MIC=3.12µg/ml | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA | Candida albicans, Shigella flexneri, Proteus vulgaris, Pseudomonas aeruginosa, Escherichia coli, Micrococcus luteus, Staphylococcus epidermidis, MRSA, Staphylococcus aureus | 1998 | 9756752 |
| antitb_1976 | KSL2 | KKVVFKFKFK | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 609 | MIC=3.12µg/ml | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA | Candida albicans, Shigella flexneri, Proteus vulgaris, Pseudomonas aeruginosa, Escherichia coli, Micrococcus luteus, Staphylococcus epidermidis, MRSA, Staphylococcus aureus | 1998 | 9756752 |
| antitb_1977 | KSL3 | KKLLFKLKFK | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 610 | NA | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA | Candida albicans, Proteus vulgaris, Pseudomonas aeruginosa, Escherichia coli, Micrococcus luteus, MRSA, Staphylococcus aureus | 1998 | 9756752 |
| antitb_1978 | KSL4 | KKLLFKLKFK | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 611 | NA | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA | Candida albicans, Proteus vulgaris, Pseudomonas aeruginosa, Escherichia coli, Micrococcus luteus, MRSA, Staphylococcus aureus | 1998 | 9756752 |
| antitb_1979 | KSL5 | KKVVPKVKFK | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 612 | NA | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA | Candida albicans, Proteus vulgaris, Pseudomonas aeruginosa, Escherichia coli, Micrococcus luteus, MRSA, Staphylococcus aureus | 1998 | 9756752 |
| antitb_1980 | Granulysin(1-35) | GRDYRTSLTIVQKLKKMVDKPTQRSVSNAATRVSR | Free | Free | butanedione (BAD) or citraconic anhydride(CAH) | Linear | 35 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 25-40% Killing -25µM | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA |  Escherichia coli | 2000 | 11120840 |
| antitb_1981 | Granulysin(1-35) | GRDYRTSLTIVQKLKKMVDKPTQRSVSNAATRVSR | Free | Free | butanedione (BAD) or citraconic anhydride(CAH) | Linear | 35 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 45-60% Killing -100 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA |  Escherichia coli | 2000 | 11120840 |
| antitb_1982 | Granulysin(36-70) | TGRSRWRDVSRNFMRRYQSRVIQGLVAGETAQQIS | Free | Free | butanedione (BAD) or citraconic anhydride(CAH) | Linear | 35 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 25-40% Killing -25µM | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA |  Escherichia coli | 2000 | 11120840 |
| antitb_1983 | Granulysin(36-70) | TGRSRWRDVSRNFMRRYQSRVIQGLVAGETAQQIS | Free | Free | butanedione (BAD) or citraconic anhydride(CAH) | Linear | 35 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 45-60% Killing -100 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA |  Escherichia coli | 2000 | 11120840 |
| antitb_1984 | Granulysin(31-50) | TRVSRTGRSRWRDVSRNFMR | Free | Free | butanedione (BAD) or citraconic anhydride(CAH) | Linear | 20 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 25-40% Killing -25µM | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA |  Escherichia coli | 2000 | 11120840 |
| antitb_1985 | Granulysin(31-50) | TRVSRTGRSRWRDVSRNFMR | Free | Free | butanedione (BAD) or citraconic anhydride(CAH) | Linear | 20 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 45-60% Killing -100 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA |  Escherichia coli | 2000 | 11120840 |
| antitb_1986 | pVEC | LLIILRRRIRKQAHAHSK | Free | Amidation | None | Linear | 18 | L | NA | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis | MIC=10µM | In vitro | HeLa cells | NA | NA | NA | NA | NA | NA | cell wall | NA | Bacillus subtilis, Staphylococcus epidermidis, Staphylococcus aureus, Escherichia coli, Pseudomonas aeruginosa, Salmonella typhimurium, Bacillus subtilis, Candida albicans etc. | 2003 | 14656995 |
| antitb_1987 | TP10 | AGYLLGKINLKALAALAKKIL | Free | Amidation | None | Linear | 21 | L | NA | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis | MIC=6µM | In vitro | HeLa cells | NA | NA | NA | NA | NA | NA | cell wall | NA | Bacillus subtilis, Staphylococcus epidermidis, Staphylococcus aureus, Escherichia coli, Pseudomonas aeruginosa, Salmonella typhimurium, Bacillus subtilis, Candida albicans etc. | 2003 | 14656995 |
| antitb_1988 | Teixobactin | FISQIISTAI | Free | Free | adenylation, C, condensation; MT, methylation (of phenylalanine); T, thiolation (carrier); and TE,thioesterase (Ile-Thr ring closure). NmPhe,N-methylated phenylalanin | Cyclic | 10 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC= 0.125µg/ml | In vitro | NA | NA | NA | NA | NA | NA | Binding of teixobactin to WTA precursor contributes to efficient lysis and killing, due to digestion of the cell wall by liberated autolysins | Cell wall | NA | S. aureus (MSSA), S. aureus 110% serum, S. aureus (MRSA), Enterococcus faecalis (VRE), Enterococcus faecium (VRE), Streptococcus pneumoniae (penicillinR), Streptococcus pyogenes, Streptococcus agalactiae, Viridans group streptococci, B. anthracis, Clostridium difficile, Propionibacterium acnes, Haemophilus influenzae, Moraxella catarrhalis, Escherichia coli, Escherichia coli (asmB1), Pseudomonas aeruginosa, Klebsiella pneumoniae | 2015 | 25561178 |
| antitb_1990 | VpAmp1.0 | LPFFLLSLIPSAISAIKKI | Free | Amidation | None | Linear | 19 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC= 17.4 ± 6.4 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall | NA | Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus agalactiae | 2015 | 26352292 |
| antitb_1991 | VpAmp1.0 | LPFFLLSLIPSAISAIKKI | Free | Amidation | None | Linear | 19 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC= 4.8 ± 1.5µM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall | NA | Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus agalactiae | 2015 | 26352292 |
| antitb_1992 | VpAmp1.1 | FFLLSLIPSAISAIKKI | Free | Amidation | None | Linear | 17 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC= 5.4 ± 1.7 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall | NA | Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus agalactiae | 2015 | 26352292 |
| antitb_1993 | VpAmp1.1 | FFLLSLIPSAISAIKKI | Free | Amidation | None | Linear | 17 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC= 8.6 ± 3.3 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall | NA | Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus agalactiae | 2015 | 26352292 |
| antitb_1994 | VpAmp2.0 | FWGFLGKLAMKAVPSLIGGNKSSSK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC= 21.4 ± 7.5 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall | NA | Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus agalactiae | 2015 | 26352292 |
| antitb_1995 | VpAmp2.0 | FWGFLGKLAMKAVPSLIGGNKSSSK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC= 30.5 ± 9.5 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall | NA | Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus agalactiae | 2015 | 26352292 |
| antitb_1996 | VpAmp2.1 | FWGFLGKLAMKAVPSLIGGNKK | Free | Free | None | Linear | 22 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC= 13.6 ± 5.3 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall | NA | Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus agalactiae | 2015 | 26352292 |
| antitb_1997 | VpAmp2.1 | FWGFLGKLAMKAVPSLIGGNKK | Free | Free | None | Linear | 22 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC= 8.5 ± 2.6 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall | NA | Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus agalactiae | 2015 | 26352292 |
| antitb_1998 | Apidaecin Ia acid( A24 C3) | GNNRPVYIPQPRPPHPRI | Free | Free | None | Linear | 18 | L | Cationic | Synthetic | Mycobaclerium vaccae | Mycobacterium vaccae | Mycobacterium vaccae | MIC = >125 | In vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Anti bacterial against - Eschericha coli 45849 and D31, - Klebsiella pneumoniae 123132 and K6,Salmonella typhi S5 and Salmonella enterica subsp. enterica serovar Typhimurium, Rhizobium radiobacter, Klebsiella pneumoniae, Bactillus subtillis | 2010 | US 0222268 A1/E |
| antitb_1999 | Api Ib 01 ac.(A18 G5 ac) | ONNRPVYIPQPRPPHPRL | Acetylation | Amidation | None | Linear | 18 | L | Cationic | Synthetic | Mycobaclerium vaccae | Mycobacterium vaccae | Mycobacterium vaccae | MIC = 125 | In vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Anti bacterial against - Eschericha coli 45849 and D31, - Klebsiella pneumoniae 123132 and K6,Salmonella typhi S5 and Salmonella enterica subsp. enterica serovar Typhimurium, Rhizobium radiobacter, Klebsiella pneumoniae, Bactillus subtillis | 2010 | US 0222268 A1/E |
| antitb_2000 | Â Api Ib 01 (A18 G5) | ONNRPVYIPQPRPPHPRL | Free | Amidation | None | Linear | 18 | L | Cationic | Synthetic | Mycobaclerium vaccae | Mycobacterium vaccae | Mycobacterium vaccae | MIC = 125 | In vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Anti bacterial against - Eschericha coli 45849 and D31, - Klebsiella pneumoniae 123132 and K6,Salmonella typhi S5 and Salmonella enterica subsp. enterica serovar Typhimurium, Rhizobium radiobacter, Klebsiella pneumoniae, Bactillus subtillis | 2010 | US 0222268 A1/E |
| antitb_2001 | Api Ib Ol RlO (Al 8 G6) | ONNRPVYIPRPRPPHPRL | Free | Amidation | None | Linear | 18 | L | Cationic | Synthetic | Mycobaclerium vaccae | Mycobacterium vaccae | Mycobacterium vaccae | MIC = 125 | In vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Anti bacterial against - Eschericha coli 45849 and D31, - Klebsiella pneumoniae 123132 and K6,Salmonella typhi S5 and Salmonella enterica subsp. enterica serovar Typhimurium, Rhizobium radiobacter, Klebsiella pneumoniae, Bactillus subtillis | 2010 | US 0222268 A1/E |
| antitb_2002 | Api Ib Ol RlO ac. | ONNRPVYIPRPRPPHPRL | Acetylation | Amidation | None | Linear | 18 | L | Cationic | Synthetic | Mycobaclerium vaccae | Mycobacterium vaccae | Mycobacterium vaccae | MIC = 125 | In vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Anti bacterial against - Eschericha coli 45849 and D31, - Klebsiella pneumoniae 123132 and K6,Salmonella typhi S5 and Salmonella enterica subsp. enterica serovar Typhimurium, Rhizobium radiobacter, Klebsiella pneumoniae, Bactillus subtillis | 2010 | US 0222268 A1/E |
| antitb_2003 | Api Ia Ol RlO ac (A18 A2 ac) | ONNRPVYIPRPRPPHPRI | Acetylation | Amidation | None | Linear | 18 | L | Cationic | Synthetic | Mycobaclerium vaccae | Mycobacterium vaccae | Mycobacterium vaccae | MIC = 62.5 | In vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Anti bacterial against - Eschericha coli 45849 and D31, - Klebsiella pneumoniae 123132 and K6,Salmonella typhi S5 and Salmonella enterica subsp. enterica serovar Typhimurium, Rhizobium radiobacter, Klebsiella pneumoniae, Bactillus subtillis | 2010 | US 0222268 A1/E |
| antitb_2004 | Api . Ib RlO (Al 8 A5) | GNNRPVYIPRPRPPHPRL | Free | Amidation | None | Linear | 18 | L | Cationic | Synthetic | Mycobaclerium vaccae | Mycobacterium vaccae | Mycobacterium vaccae | MIC = 125 | In vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Anti bacterial against - Eschericha coli 45849 and D31, - Klebsiella pneumoniae 123132 and K6,Salmonella typhi S5 and Salmonella enterica subsp. enterica serovar Typhimurium, Rhizobium radiobacter, Klebsiella pneumoniae, Bactillus subtillis | 2010 | US 0222268 A1/E |
| antitb_2005 | Api Ib RlO acety. (A18 A5 ac ) | GNNRPVYIPRPRPPHPRL | Acetylation | Amidation | None | Linear | 18 | L | Cationic | Synthetic | Mycobaclerium vaccae | Mycobacterium vaccae | Mycobacterium vaccae | MIC = 125 | In vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Anti bacterial against - Eschericha coli 45849 and D31, - Klebsiella pneumoniae 123132 and K6,Salmonella typhi S5 and Salmonella enterica subsp. enterica serovar Typhimurium, Rhizobium radiobacter, Klebsiella pneumoniae, Bactillus subtillis | 2010 | US 0222268 A1/E |
| antitb_2006 | Api Ib OIO Hyp 11 ( Al 8 B4) | GNNRPVYIPO-4tHyp-RPPHPRL | Free | Amidation | 4tHyp= hydroxyprolin | Linear | 18 | L | Cationic | Synthetic | Mycobaclerium vaccae | Mycobacterium vaccae | Mycobacterium vaccae | MIC = 125 | In vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Anti bacterial against - Eschericha coli 45849 and D31, - Klebsiella pneumoniae 123132 and K6,Salmonella typhi S5 and Salmonella enterica subsp. enterica serovar Typhimurium, Rhizobium radiobacter, Klebsiella pneumoniae, Bactillus subtillis | 2010 | US 0222268 A1/E |
| antitb_2007 | Â Api Ia, OIO ( Al 7 A4 ) | GNNRPVYIPOPRPPHPRI | Free | Amidation | None | Linear | 18 | L | Cationic | Synthetic | Mycobaclerium vaccae | Mycobacterium vaccae | Mycobacterium vaccae | MIC = 125 | In vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Anti bacterial against - Eschericha coli 45849 and D31, - Klebsiella pneumoniae 123132 and K6,Salmonella typhi S5 and Salmonella enterica subsp. enterica serovar Typhimurium, Rhizobium radiobacter, Klebsiella pneumoniae, Bactillus subtillis | 2010 | US 0222268 A1/E |
| antitb_2008 | Â Api Ia R 10 Hyp 11 (Al 7 B3) | GNNRPVYIPR-4tHyp-RPPHPRI | Free | Amidation | 4tHyp= hydroxyprolin | Linear | 18 | L | Cationic | Synthetic | Mycobaclerium vaccae | Mycobacterium vaccae | Mycobacterium vaccae | MIC = 125 | In vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Anti bacterial against - Eschericha coli 45849 and D31, - Klebsiella pneumoniae 123132 and K6,Salmonella typhi S5 and Salmonella enterica subsp. enterica serovar Typhimurium, Rhizobium radiobacter, Klebsiella pneumoniae, Bactillus subtillis | 2010 | US 0222268 A1/E |