Browse result page of AntiTbPdb
The total number entries retrieved from this search are 452
| ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| antitb_1378 | Mycobacterial tuberculosis DHFR tripeptide analog | WPY | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 9.55 × 10−8 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1379 | Mycobacterial tuberculosis DHFR tripeptide analog | WYP | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 4.57 × 10−8 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1380 | Mycobacterial tuberculosis DHFR tripeptide analog | WPW | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 4.27 × 10−6 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1381 | Mycobacterial tuberculosis DHFR tripeptide analog | WYW | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 1.45 × 10−7 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1382 | Mycobacterial tuberculosis DHFR tripeptide analog | WYS | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 1.44 × 10−8 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1383 | Mycobacterial tuberculosis DHFR tripeptide analog | WPS | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 7.94 × 10−8 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1384 | Mycobacterial tuberculosis DHFR tripeptide analog | WPT | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 2.95 × 10−7 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1385 | Mycobacterial tuberculosis DHFR tripeptide analog | WYT | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 3.31 × 10−6 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1386 | Mycobacterial tuberculosis DHFR tripeptide analog | YPS | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 8.91 × 10−6 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1387 | Mycobacterial tuberculosis DHFR tripeptide analog | YPT | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 6.46 × 10−6 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1405 | D-LAK120 | KKLALLALKKWLLALKKLALLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis susceptible strain | NA | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1406 | D-LAK120 | KKLALLALKKWLLALKKLALLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR strain | MIC = 50 μM | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1407 | D-LAK120-P13 | KKLALLALKKWLPALKKLALLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR strain | MIC = 100 μM | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1408 | D-LAK120-A | KKLALALAKKWLALAKKLALALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR strain | MIC = 25 μM | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1409 | D-LAK120-HP13 | KKALAHALKKWLPALKKLAHALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR strain | MIC = 25 μM | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1410 | D-LAK120-H | KKLALHALKKWLHALKKLAHLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR strain | NA | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1411 | D-LAK120 | KKLALLALKKWLLALKKLALLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain | MIC = 50 μM | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1412 | D-LAK120-P13 | KKLALLALKKWLPALKKLALLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain | MIC = 100 μM | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1413 | D-LAK120-A | KKLALALAKKWLALAKKLALALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain | MIC = 100 μM | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1414 | D-LAk120-AP13 | KKLALALAKKWLPLAKKLALALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain | NA | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1415 | D-LAK120-H | KKLALHALKKWLHALKKLAHLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain | MIC = 100 μM | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1416 | D-LAK120-HP13 | KKALAHALKKWLPALKKLAHALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain | 50 μM | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1417 | D-LAK120 | KKLALLALKKWLLALKKLALLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain | NA | in vitro | THP-1 cell line | EC50(effective concentration) =14.4 ± 3.3 μM | No cytotoxicity | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1418 | D-LAK120-P13 | KKLALLALKKWLPALKKLALLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain | NA | in vitro | THP-1 cell line | EC50 =17.9 ± 1.7 μM | No cytotoxicity | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1419 | D-LAK120-A | KKLALALAKKWLALAKKLALALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain | NA | in vitro | THP-1 cell line | EC50 = 31.9 ± 9.5 μM | Cytotoxic at > 25 μM | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1420 | D-LAk120-AP13 | KKLALALAKKWLPLAKKLALALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain | NA | in vitro | THP-1 cell line | EC50 = 32.1 ± 4.8 μM | Cytotoxic at > 25 μM | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1421 | D-LAK120-H | KKLALHALKKWLHALKKLAHLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain | NA | in vitro | THP-1 cell line | EC50 = 32.2 ± 5.5 μM | Cytotoxic at12.5 μM | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1422 | D-LAK120-HP13 | KKALAHALKKWLPALKKLAHALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain | NA | in vitro | THP-1 cell line | EC50 = 32.3 ± 4.7 μM | Cytotoxic above 3.13 μM | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1423 | D-LAK120-H | KKLALHALKKWLHALKKLAHLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR strain GB2 | NA | Ex vivo | THP-1 cell line | NA | Cytotoxic at > 25 μM | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1424 | D-LAK120-HP13 | KKALAHALKKWLPALKKLAHALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR strain GB2 | NA | Ex vivo | THP-1 cell line | NA | Cytotoxic at > 25 μM | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1425 | D-LAK120-A | KKLALALAKKWLALAKKLALALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR strain GB2 | NA | Ex vivo | THP-1 cell line | NA | Cytotoxic at12.5 μM | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1426 | D-LAk120-AP13 | KKLALALAKKWLPLAKKLALALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR strain GB2 | NA | Ex vivo | THP-1 cell line | NA | Cytotoxic above 3.13 μM | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1427 | D-LAK120-H | KKLALHALKKWLHALKKLAHLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain WYC-11 | NA | Ex vivo | THP-1 cell line | NA | Cytotoxic at > 25 μM | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1428 | D-LAK120-HP13 | KKALAHALKKWLPALKKLAHALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain WYC-11 | NA | Ex vivo | THP-1 cell line | NA | Cytotoxic at > 25 μM | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1429 | D-LAK120-A | KKLALALAKKWLALAKKLALALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain WYC-11 | NA | Ex vivo | THP-1 cell line | NA | Cytotoxic at12.5 μM | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1430 | D-LAk120-AP13 | KKLALALAKKWLPLAKKLALALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain WYC-11 | NA | Ex vivo | THP-1 cell line | NA | Cytotoxic above 3.13 μM | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1431 | D-LAk120-AP13 | KKLALALAKKWLPLAKKLALALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain WYC-11 | MIC = 3.13 μM | In vitro | THP-1 cell line | NA | NA | NA | NA | NA | NA | NA | INH+D-LAK120-HP13 | NA | 2014 | 25154927 |
| antitb_1524 | NK-Lysin | NEDTVTQAASRVCDKMKILRGVCKKIMRTFLRRISKD | Free | Free | None | Linear | 36 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | Reduction in bacterial growth inhibiton to 60% at conc. Of 9.37 mg/L | in vitro | NA | NA | NA | NA | NA | NA | Inteacting with microbial membrane | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 |
| antitb_1525 | N22 | VCEHIHLIRGLCHHLMHSYIKR | Free | Free | None | Linear | 21 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | Reduction in bacterial growth inhibiton to 59% at conc. Of 50 mg/L | in vitro | NA | NA | Low toxicity to erythrocyte | NA | NA | Inteacting with microbial membrane | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 | |
| antitb_1526 | NKLF2 | VCDKMKILRGVCKKIMRSFLRR | Free | Free | None | Linear | 21 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | NA | in vitro | NA | NA | NA | NA | NA | Inteacting with microbial membrane | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 | |
| antitb_1527 | Human neutrohil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | cyclic | 30 | L | Cationic | Synthetic | Human neutrophil | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | NA | in vitro | NA | NA | NA | NA | NA | Inteacting with microbial membrane | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 | |
| antitb_1607 | TP-5 | RKDVY | Free | Amidation | None | Linear | 4 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-susceptible | MIC = > 1000mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
| antitb_1608 | RR-6 | RRRRRR | Free | Amidation | None | Linear | 5 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-susceptible | MIC = 125 mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
| antitb_1609 | RR-11 | RKDVYRRRRRR | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-susceptible | MIC = 125 mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
| antitb_1610 | RY-11 | RRRRRRRKDVY | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-susceptible | MIC = 125 mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
| antitb_1611 | TP-5 | RKDVY | Free | Amidation | None | Linear | 4 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-Resistance | NA | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
| antitb_1612 | RR-6 | RRRRRR | Free | Amidation | None | Linear | 5 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-Resistance | MIC = 125 mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
| antitb_1613 | RR-11 | RKDVYRRRRRR | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-Resistance | MIC = 125 mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
| antitb_1614 | RY-11 | RRRRRRRKDVY | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-Resistance | MIC = 125 mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
| antitb_1615 | RY-11 | RRRRRRRKDVY | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-Resistance | MIC = 125 mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | RR-11 Peptide(31.25 mg/L) + Rifampicin (1.95mg/L) | NA | 2014 | 24411680 |