Browse result page of AntiTbPdb
The total number entries retrieved from this search are 434
| ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| antitb_1159 | Nisin T | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMT-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium smegmatis | Mycobacterium smegmatis MC2155 | 2.7 mm zone of activity as compared to Nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
| antitb_1160 | Nisin T | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMT-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Ra | 24% more inhibition as compared to nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
| antitb_1161 | Nisin T | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMT-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium kansasii | Mycobacterium kansasii CIT11/06 | 24% more inhibition as compared to nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
| antitb_1162 | Nisin T | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMT-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium avium | Mycobacterium avium subsp. Hominissuis (CIT05/03) | 16% more inhibition as compared to nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
| antitb_1163 | Nisin T | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMT-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium avium | Mycobacterium avium paratuberculosis (ATCC 19698) | 27% decrease in growth relative to nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
| antitb_1183 | SL3 | AAARIRHEGVFLLIGNSCFSLPRNGPQLLLLAW | Free | Free | None | Linear | 33 | L | NA | Natural | Isolated from lung cDNA library | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | 45% reduction in growth was observed | Both | THP-1 cells | Drastic reduction (~80%) in M.tb intracellular survival after 72 hrs of infection | No cytotoxicty | BALB/c female mice at 6–8 weeks of age | NA | NA | Disruption in mycobacterila secretory and cell wall biosynthetic pathway | Molecules specific to mycobacterial cell | None | None | 2014 | 25349777 |
| antitb_1184 | H37Rv/SL3 | AAARIRHEGVFLLIGNSCFSLPRNGPQLLLLAW | Free | 6-histidine | None | Linear | 33 | L | NA | Natural | Expressing SL3-His6X endogenously | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | 45% reduction in growth was observed | Both | THP-1 cells | Drastic reduction (~80%) in M.tb intracellular survival after 72 hrs of infection | No cytotoxicty | BALB/c female mice at 6–8 weeks of age | NA | NA | Disruption in mycobacterila secretory and cell wall biosynthetic pathway | Molecules specific to mycobacterial cell | Endogenously produced with in M.tb | None | 2014 | 25349777 |
| antitb_1185 | Pin2 | FWGALAKGALKLIPSLFSSFSKKD | Free | Free | None | Linear | 24 | L | Cationic | Natural | Venom of the African scorpion Pandinus imperator | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 57.7 ± 22.3 μg/ml or 22.1 ± 8.6 μM | In vitro | RBC | NA | Hemolysis ( IC-50 = 3.3 [1.9–5.7]) | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
| antitb_1186 | Pin2 | FWGALAKGALKLIPSLFSSFSKKD | Free | Free | None | Linear | 24 | L | Cationic | Natural | Venom of the African scorpion Pandinus imperator | Mycobacterium tuberculosis | Mycobacterium tuberculosis muti-drug resistant strain (MDR) clinical isolate | MIC = 86.5 μg/ml or 33.1 μM | In vitro | RBC | NA | Hemolysis ( IC-50 = 3.3 [1.9–5.7]) | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
| antitb_1201 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 0.78–1.56 μg/ml or 0.41–0.83 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |
| antitb_1202 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium tuberculosis | Mycobacterium tuberculosis susceptible 186 clinical isolate | MIC = 1.56 μg/ml or 0.83 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |
| antitb_1203 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium tuberculosis | Mycobacterium tuberculosis susceptible 83 clinical isolate | MIC = 1.56-3.1 μg/ml or 0.83 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |
| antitb_1204 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to INH, STR (84) | MIC = 1.56-3.1 μg/ml or 0.83 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |
| antitb_1205 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to INH, RIF (85) | MIC = 1.56-3.1 μg/ml or 0.83 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |
| antitb_1206 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to INH, RIF (7) | MIC = 1.56 μg/ml or 0.83 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |
| antitb_1207 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to INH, RIF, STR (86) | MIC = 1.56 μg/ml or 0.83 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |
| antitb_1208 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to INH, RIF, STR, FQ (136) | MIC = 0.78 μg/ml or 0.41 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |
| antitb_1209 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to INH, RIF, STR, FQ (133) | MIC = 0.78 μg/ml or 0.41 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |
| antitb_1210 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to INH, RIF, STR, FQ (189) | MIC = 3.1 μg/ml or 1.65 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |
| antitb_1211 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to INH, RIF, EMB, FQ (3) | MIC = 3.1 μg/ml or 1.65 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |
| antitb_1212 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to INH, RIF, EMB, PZA, FQ (30) | MIC = 0.78 μg/ml or 0.41 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |
| antitb_1213 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to INH, RIF, EMB, PZA, FQ (181) | MIC = 0.78 μg/ml or 0.41 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |
| antitb_1214 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to INH, RIF, STR, EMB, PZA, FQ (183) | MIC = 3.1 μg/ml or 1.65 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |
| antitb_1215 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to INH, RIF, STR, EMB, PZA, FQ (188) | MIC = 3.1 μg/ml or 1.65 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |
| antitb_1216 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium tuberculosis | Mycobacterium tuberculosis mc26020 | MIC = 0.39-0.78 μg/ml or 0.21-0.41 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |
| antitb_1217 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium avium | Mycobacterium avium subsp. Paratuberculosis | MIC = 0.125-0.25 μg/ml or 0.07-0.13 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |
| antitb_1218 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium smegmatis | Mycobacterium smegmatis | MIC = 0.78-2 μg/ml or 0.41-1.06 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |
| antitb_1256 | Eosinophil Cationic Protein (RNase 3) | RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNN | Free | Free | Disulphide linkage | Cyclic | 70 | L | Cationic | Natural | Secreted by eosinophil secondary granules | Mycobacterium vaccae | Mycobacterium vaccae strain (ATCC 15483) | MIC = 20.0 ± 1.0 μM | In vitro | None | NA | NA | None | NA | NA | Membrane depolarization and permeabilization | Cell envelope | None | Antibacterial and Antiparasitic | 2013 | 23716047 |
| antitb_1257 | Eosinophil Cationic Protein (RNase 3) | RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNN | Free | Free | Disulphide linkage | Cyclic | 70 | L | Cationic | Natural | Secreted by eosinophil secondary granules | Mycobacterium vaccae | Mycobacterium vaccae strain (ATCC 15483) | IC50 = 11.6 ± 0.2 μM | In vitro | None | NA | NA | None | NA | NA | Membrane depolarization and permeabilization | Cell envelope | None | Antibacterial and Antiparasitic | 2013 | 23716047 |
| antitb_1258 | RNase 7 | KPKGMTSSQWFKIQHMOPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKN | Free | Free | Disulphide linkage | Cyclic | 68 | L | Cationic | Natural | Secreted by innate cells during host defense | Mycobacterium vaccae | Mycobacterium vaccae strain (ATCC 15483) | MIC = 20.0 ± 0.5 μM | In vitro | None | NA | NA | None | NA | NA | Membrane depolarization and permeabilization | Cell envelope | None | Antibacterial and Antiparasitic | 2013 | 23716047 |
| antitb_1259 | RNase 7 | KPKGMTSSQWFKIQHMOPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKN | Free | Free | Disulphide linkage | Cyclic | 68 | L | Cationic | Natural | Secreted by innate cells during host defense | Mycobacterium vaccae | Mycobacterium vaccae strain (ATCC 15483) | IC50 = 9.3 ± 1.2 μM | In vitro | None | NA | NA | None | NA | NA | Membrane depolarization and permeabilization | Cell envelope | None | Antibacterial and Antiparasitic | 2013 | 23716047 |
| antitb_1287 | Bcn1Â | FVYGNGVTSILVQAQFLVNGQRRFFYTPDK | Free | Free | None | Linear | 30 | L | NA | Natural | Isolated from diverse Gram-positive bacteria species | Mycobacterium tuberculosis | Mycobacterium tuberculosis strain H37Rv | MIC90 = 0.1 mg/L | Both | Mouse macrophages | No inhibition | No cytotoxicty | None | NA | NA | Formation of pores in cell membranes | Cell envelope | None | None | 2007 | 17347179 |
| antitb_1288 | Bcn2 | ATYYGNGLYCNKQKHYTWVDWNKASREIGKITVNGWVQH | Free | Free | None | Linear | 39 | L | NA | Natural | Isolated from diverse Gram-positive bacteria species | Mycobacterium tuberculosis | Mycobacterium tuberculosis strain H37Rv | MIC90 = 0.1 mg/L | Both | Mouse macrophages | No inhibition | Negligible at a concentration of 1 mg/L | None | NA | NA | Formation of pores in cell membranes | Cell envelope | None | None | 2007 | 17347179 |
| antitb_1289 | Bcn3 | KTYYGTNGVHCTKNSLWGKVRLKNMKYDQNTTYMGRLQDILLGWATGAFGKTH | Free | Free | None | Linear | 53 | L | NA | Natural | Isolated from diverse Gram-positive bacteria species | Mycobacterium tuberculosis | Mycobacterium tuberculosis strain H37Rv | MIC90 = 0.1 mg/L | Both | Mouse macrophages | No inhibition | Negligible at a concentration of 1 mg/L | None | NA | NA | Formation of pores in cell membranes | Cell envelope | None | None | 2007 | 17347179 |
| antitb_1290 | Bcn4 | RWYYGNGVGGVGGAAVCGLAGYVGEAKENIAGEVRKGWGMAGGFTHNKACKSFPGSGWASG | Free | Free | None | Linear | 61 | L | NA | Natural | Isolated from diverse Gram-positive bacteria species | Mycobacterium tuberculosis | Mycobacterium tuberculosis strain H37Rv | MIC90 = 0.1 mg/L | Both | Mouse macrophages | No inhibition | No cytotoxicty | None | NA | NA | Formation of pores in cell membranes | Cell envelope | None | None | 2007 | 17347179 |
| antitb_1291 | Bcn5 | TTKNYGNGVCNSVNWCQCGNVWASCNLATGCAAWLCKLA | Free | Free | None | Linear | 39 | L | NA | Natural | Isolated from diverse Gram-positive bacteria species | Mycobacterium tuberculosis | Mycobacterium tuberculosis strain H37Rv | MIC90 = 0.1 mg/L | Both | Mouse macrophages | No inhibition | No cytotoxicty | C57BL/6JCit (B6) feamale mice of age 14 | 10 mg/mouse of Bcn5 | NA | Formation of pores in cell membranes | Cell envelope | None | None | 2007 | 17347179 |
| antitb_1292 | Bcn5 | TTKNYGNGVCNSVNWCQCGNVWASCNLATGCAAWLCKLA | Free | Free | None | Linear | 39 | L | NA | Natural | Isolated from diverse Gram-positive bacteria species | Mycobacterium tuberculosis | Mycobacterium tuberculosis strain H37Rv | NA | Both | Mouse macrophages | No inhibition | No cytotoxicty | C57BL/6JCit (B6) feamale mice of age 15 | 10 mg/mouse of Bcn5-PhC complex | NA | Formation of pores in cell membranes | Cell envelope | Mixture of phosphatidylcholine (Ph) and cardiolipin (C) with Bcn5 | None | 2007 | 17347179 |
| antitb_1293 | Trichoderins A | (MDA)-P-(AHMOD)-(Aib)-(Aib)-I-V-(Aib)-(Aib)-(AMAE) | Addition of MDA = 2-methyl decanoic acid. | Addition of AMAE = 2-[(20-aminopropyl) methylamino] ethanol. | AHMOD = 2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid, Aib = α-amino- isobutyric acid | Linear | 8 | L | NA | Natural | Isolated from a culture of marine sponge derived fungus of Trichoderma sp. | Mycobacterium smegmatis | Mycobacterium smegmatis | MIC = 0.1 μg/mL | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | None | 2010 | 20483615 |
| antitb_1294 | Trichoderins A | (MDA)-P-(AHMOD)-(Aib)-(Aib)-I-V-(Aib)-(Aib)-(AMAE) | Addition of MDA = 2-methyl decanoic acid. | Addition of AMAE = 2-[(20-aminopropyl) methylamino] ethanol. | AHMOD = 2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid, Aib = α-amino- isobutyric acid | Linear | 8 | L | NA | Natural | Isolated from a culture of marine sponge derived fungus of Trichoderma sp. | Mycobacterium bovis | Mycobacterium bovis BCG | MIC =0.02 μg/mL | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | None | 2010 | 20483615 |
| antitb_1295 | Trichoderins A | (MDA)-P-(AHMOD)-(Aib)-(Aib)-I-V-(Aib)-(Aib)-(AMAE) | Addition of MDA = 2-methyl decanoic acid. | Addition of AMAE = 2-[(20-aminopropyl) methylamino] ethanol. | AHMOD = 2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid, Aib = α-amino- isobutyric acid | Linear | 8 | L | NA | Natural | Isolated from a culture of marine sponge derived fungus of Trichoderma sp. | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 0.12 μg/mL | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | None | 2010 | 20483615 |
| antitb_1296 | Trichoderins A1 | (MDA)-P-(AMOD)-(Aib)-(Aib)-I-V-(Aib)-(Aib)-(AMAE) | Addition of MDA = 2-methyl decanoic acid. | Addition of AMAE = 2-[(20-aminopropyl) methylamino] ethanol. | AMOD = 2-amino-4-methy1-8-oxodec-6-enoic acid, Aib = a-amino- isobutyric acid, | Linear | 8 | L | NA | Natural | Isolated from a culture of marine sponge derived fungus of Trichoderma sp. | Mycobacterium smegmatis | Mycobacterium smegmatis | MIC = 1.56 μg/mL | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | None | 2010 | 20483615 |
| antitb_1297 | Trichoderins A1 | (MDA)-P-(AMOD)-(Aib)-(Aib)-I-V-(Aib)-(Aib)-(AMAE) | Addition of MDA = 2-methyl decanoic acid. | Addition of AMAE = 2-[(20-aminopropyl) methylamino] ethanol. | AMOD = 2-amino-4-methy1-8-oxodec-6-enoic acid, Aib = a-amino- isobutyric acid, | Linear | 8 | L | NA | Natural | Isolated from a culture of marine sponge derived fungus of Trichoderma sp. | Mycobacterium bovis | Mycobacterium bovis BCG | MIC = 0.16 μg/mL | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | None | 2010 | 20483615 |
| antitb_1298 | Trichoderins A1 | (MDA)-P-(AMOD)-(Aib)-(Aib)-I-V-(Aib)-(Aib)-(AMAE) | Addition of MDA = 2-methyl decanoic acid. | Addition of AMAE = 2-[(20-aminopropyl) methylamino] ethanol. | AMOD = 2-amino-4-methy1-8-oxodec-6-enoic acid, Aib = a-amino- isobutyric acid, | Linear | 8 | L | NA | Natural | Isolated from a culture of marine sponge derived fungus of Trichoderma sp. | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 2.0 μg/mL | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | None | 2010 | 20483615 |
| antitb_1299 | Trichoderins B | (MDA)-P-(AHMOD)-(Aib)-(Aib)-V-V-(Aib)-(Aib)-(AMAE) | Addition of MDA = 2-methyl decanoic acid. | Addition of AMAE = 2-[(20-aminopropyl) methylamino] ethanol. | AHMOD = 2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid, Aib = α-amino- isobutyric acid | Linear | 8 | L | NA | Natural | Isolated from a culture of marine sponge derived fungus of Trichoderma sp. | Mycobacterium smegmatis | Mycobacterium smegmatis | MIC =0.63 μg/mL | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | None | 2010 | 20483615 |
| antitb_1300 | Trichoderins B | (MDA)-P-(AHMOD)-(Aib)-(Aib)-V-V-(Aib)-(Aib)-(AMAE) | Addition of MDA = 2-methyl decanoic acid. | Addition of AMAE = 2-[(20-aminopropyl) methylamino] ethanol. | AHMOD = 2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid, Aib = α-amino- isobutyric acid | Linear | 8 | L | NA | Natural | Isolated from a culture of marine sponge derived fungus of Trichoderma sp. | Mycobacterium bovis | Mycobacterium bovis BCG | MIC = 0.02 μg/mL | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | None | 2011 | 20483615 |
| antitb_1301 | Trichoderins B | (MDA)-P-(AHMOD)-(Aib)-(Aib)-V-V-(Aib)-(Aib)-(AMAE) | Addition of MDA = 2-methyl decanoic acid. | Addition of AMAE = 2-[(20-aminopropyl) methylamino] ethanol. | AHMOD = 2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid, Aib = α-amino- isobutyric acid | Linear | 8 | L | NA | Natural | Isolated from a culture of marine sponge derived fungus of Trichoderma sp. | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 0.13 μg/mL | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | None | 2012 | 20483615 |
| antitb_1302 | Ubiquitin-derived peptide (Ub2) | STLHLVLRLRGG | Free | Free | None | Linear | 12 | L | Cationic | Natural | Ubiquitin derived | Mycobacterium smegmatis | M. smegmatis mc2 155 | 1.5 fold reduction in bacterial colony as compared to control at 50 μM of peptide | In vitro | NA | NA | NA | NA | NA | NA | Pore formation in Mycobacterial membrane | mspA gene which form porins in membrane, peptide increase the expression of this gene | NA | NA | 2009 | 19682257 |
| antitb_1303 | Ubiquitin-derived peptide (Ub2) | STLHLVLRLRGG | Free | Free | None | Linear | 12 | L | Cationic | Natural | Ubiquitin derived | Mycobacterium smegmatis | M. smegmatis mc2 155 | 1.5 fold reduction in bacterial colony as compared to control at 60 μM of peptide | In vitro | NA | NA | NA | NA | NA | NA | Pore formation in Mycobacterial membrane | mspA gene which form porins in membrane, peptide increase the expression of this gene | NA | NA | 2009 | 19682257 |
| antitb_1304 | Ubiquitin-derived peptide (Ub2) | STLHLVLRLRGG | Free | Free | None | Linear | 12 | L | Cationic | Natural | Ubiquitin derived | Mycobacterium smegmatis | M. smegmatis mc2 155 | 2.5 fold reduction in bacterial colony as compared to control at75 μM | In vitro | NA | NA | NA | NA | NA | NA | Pore formation in Mycobacterial membrane | mspA gene which form porins in membrane, peptide increase the expression of this gene | NA | NA | 2009 | 19682257 |
| antitb_1305 | Ubiquitin-derived peptide (Ub2) | STLHLVLRLRGG | Free | Free | None | Linear | 12 | L | Cationic | Natural | Ubiquitin derived | Mycobacterium smegmatis | M. smegmatis mc2 155 | 3 fold reduction in bacterial colony as compared to control at100 μM | In vitro | NA | NA | NA | NA | NA | NA | Pore formation in Mycobacterial membrane | mspA gene which form porins in membrane, peptide increase the expression of this gene | NA | NA | 2009 | 19682257 |