| ID | 1806 |
| PMID | 15937518 |
| Sequence | GRKKRRQRRRPPQTYADFIASGRTGRRNAI |
| Chirality | L |
| Peptide name | Tat-PKI |
| Origin | HIV-1 and protein kinase Inhibitor |
| Family | Protein derived |
| Category | Unknown |
| Localization | Unknown |
| N terminal | Rhodamine-labelled |
| C terminal | Free |
| Uptake efficiency | Less than polyarginine-PKI, Antp-PKI and Transport |
| Uptake mechanism | Lipid raft-dependent but clathrin-independent endocytic process |
| Cancer cell lines | CHO K1, HeLa, A549 cells |
| Patent number | Unknown |
| 3D structure |
|