| ID | 1804 |
| PMID | 15937518 |
| Sequence | RQIKIWFQNRRMKWKKTYADFIASGRTGRRNAI |
| Chirality | L |
| Peptide name | pAntp–PKI |
| Origin | Antennapedia homeodomain of drosophila and protein |
| Family | Protein derived |
| Category | Unknown |
| Localization | Unknown |
| N terminal | Rhodamine-labelled |
| C terminal | Free |
| Uptake efficiency | Less than Polyarginine-PKI and transportan-PKI but |
| Uptake mechanism | Lipid raft-dependent but clathrin-independent endocytic process |
| Cancer cell lines | CHO K1, HeLa, A549 cells |
| Patent number | Unknown |
| 3D structure |
|