| ID | 1539 |
| PMID | 7782278 |
| Sequence | AAVALLPAVLLALLAPEILLPNNYNAYESYKYPGMFIALSK |
| Chirality | L |
| Peptide name | SKP |
| Origin | Signal sequence of K-FGF + C-terminal region of (1 |
| Family | Chimeric |
| Category | Unknown |
| Localization | Unknown |
| N terminal | Tyrosine radiolabeling with Iodine 125 |
| C terminal | Free |
| Uptake efficiency | Unknown |
| Uptake mechanism | Non-receptor mediated import mechanism |
| Cancer cell lines | NIH-3T3 |
| Patent number | Unknown |
| 3D structure |
|