| ID | 1489 |
| PMID | 14963039 |
| Sequence | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESC |
| Chirality | L |
| Peptide name | LL-37 |
| Origin | Human cathelin-associated peptide |
| Family | Protein derived |
| Category | Antimicrobial |
| Localization | Nucleus |
| N terminal | Unknown |
| C terminal | Amidation |
| Uptake efficiency | Unknown |
| Uptake mechanism | Membrane raft endocytosis and proteoglycan-dependent endocytic process |
| Cancer cell lines | COS-7, HFL-1 and CHO-K1 cells |
| Patent number | Unknown |
| 3D structure |
|