| ID | 1488 |
| PMID | 12435392 |
| Sequence | MVKSKIGSWILVLFVAMWSDVGLCKKRPKP |
| Chirality | L |
| Peptide name | Bovine Prp (1-30) |
| Origin | Prion protein |
| Family | Protein derived |
| Category | Amphipathic |
| Localization | Probably perinuclearly and in the cytosol |
| N terminal | Labelled with fluoresceine |
| C terminal | Amidation |
| Uptake efficiency | Unknown |
| Uptake mechanism | Unknown |
| Cancer cell lines | Human bowes melanoma, N1e neuroblastoma and N2A cells |
| Patent number | Unknown |
| 3D structure |
|