ID | 1251 |
PMID | 16620748 |
Sequence | ADVFDRGGPYLQRGVADLVPTATLLDTYSP |
Chirality | L |
Peptide name | Inv9 |
Origin | Mycobacterium cell entry protein (Mce1A) |
Family | Protein derived |
Category | Unknown |
Localization | Cytoplasm and nucleus membrane |
N terminal | Free (peptide coated FITC labelled microspheres) |
C terminal | Free |
Uptake efficiency | Low (relative to Inv3) |
Uptake mechanism | Unknown |
Cancer cell lines | HeLa |
Patent number | Unknown |
3D structure |
|