| ID | 1248 |
| PMID | 16620748 |
| Sequence | GLGDKFGESIVNANTVLDDLNSRMPQSRHDIQQL |
| Chirality | L |
| Peptide name | Inv6 |
| Origin | Mycobacterium cell entry protein (Mce1A) |
| Family | Protein derived |
| Category | Unknown |
| Localization | Cytoplasm and nucleus membrane |
| N terminal | Free (peptide coated FITC labelled microspheres) |
| C terminal | Free |
| Uptake efficiency | Low (relative to Inv3) |
| Uptake mechanism | Unknown |
| Cancer cell lines | HeLa |
| Patent number | Unknown |
| 3D structure |
|