Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID11035 | IHTGENPYECSECGKAFRYSSALVRHQRIHTGEKPLNGIGMSKSSLRVTTELN | zinc finger protein 3 | Serum | 5905.23 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |