Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID4636 | DLPAVSEKDIQDLKFGVEQDVDM | Isoform M2 of Pyruvate kinase isozymes M1/M2 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4637 | DLPAVSEKDIQDLKFGVEQDVDMVF | Isoform M2 of Pyruvate kinase isozymes M1/M2 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4643 | DLRVNFAMNV | Isoform M2 of Pyruvate kinase isozymes M1/M2 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4790 | EVGSKIYVDDGLI | Isoform M2 of Pyruvate kinase isozymes M1/M2 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5157 | GIICTIGPASRSVETL | Isoform M2 of Pyruvate kinase isozymes M1/M2 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5293 | GSKIYVDDGLI | Isoform M2 of Pyruvate kinase isozymes M1/M2 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5713 | LCKDPVQEAW | Isoform M2 of Pyruvate kinase isozymes M1/M2 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5714 | LCKDPVQEAWAEDV | Isoform M2 of Pyruvate kinase isozymes M1/M2 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6198 | MLSGETAKGDYPLEAV | Isoform M2 of Pyruvate kinase isozymes M1/M2 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6313 | NLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFA | Isoform M2 of Pyruvate kinase isozymes M1/M2 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7464 | TLDNAYMEKCDENI | Isoform M2 of Pyruvate kinase isozymes M1/M2 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID11517 | GTAEVELKK | Pyruvate kinase PKM | Serum | NA | LC-MS | Melanoma | "Present in 5 cancer samples out of 8 cancer samples. ,Present in 1 healthy samples out of 4 healthy samples." | 26992070 |