| Primary information |
|---|
| sequence ID | Seq_5688 |
| Peptide sequence | NLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFA |
| CancerPDF_ID | CancerPDF_ID6313, |
| PMID | 24982608 |
| Protein Name | Isoform M2 of Pyruvate kinase isozymes M1/M2 |
| UniprotKB Entry Name | KPYM_HUMAN |
| Fluid | Urine |
| Profiling Technique | Nano-LC-MS |
| Peptide Identification technique | MS/MS |
| Labelled/Label Free | Label Free |
| FDR | 0.01 |
| CancerPDF_ID | CancerPDF_ID6313, |
| p-Value | NA |
| Software | "GPM search engine, MASCOT" |
| Length | 33 |
| Cancer Type | Ovarian cancer |
| Database | IPI 3.71 Human Database |
| Modification | NA |
| Number of Patients | 6 Ovarian cancer patients and 6 normal individuals |
| Regulation | Uniquely present in case of urine of ovarian cancer patients |
| Validation | NA |
| Sensitivity | NA |
| Specificity | NA |
| Accuracy | NA |
| Peptide Atlas | NA |
| IEDB | NA |