Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID4208 | AINDPFIDLNYM | Glyceraldehyde-3-phosphate dehydrogenase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4209 | AINDPFIDLNYMV | Glyceraldehyde-3-phosphate dehydrogenase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4210 | AINDPFIDLNYMVY | Glyceraldehyde-3-phosphate dehydrogenase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5360 | HDNFGIVEGLM | Glyceraldehyde-3-phosphate dehydrogenase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5361 | HDNFGIVEGLMT | Glyceraldehyde-3-phosphate dehydrogenase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5467 | IHDNFGIVEGLMT | Glyceraldehyde-3-phosphate dehydrogenase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5468 | IHDNFGIVEGLMTT | Glyceraldehyde-3-phosphate dehydrogenase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5469 | IHDNFGIVEGLMTTV | Glyceraldehyde-3-phosphate dehydrogenase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5470 | IHDNFGIVEGLMTTVH | Glyceraldehyde-3-phosphate dehydrogenase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5471 | IHDNFGIVEGLMTTVHAI | Glyceraldehyde-3-phosphate dehydrogenase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5522 | ISAPSADAPMFV | Glyceraldehyde-3-phosphate dehydrogenase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5535 | ISWYDNEFGYSNRVV | Glyceraldehyde-3-phosphate dehydrogenase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5668 | KWGDAGAEYV | Glyceraldehyde-3-phosphate dehydrogenase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5692 | LAPLAKVIHDNFGIVEGLMTTV | Glyceraldehyde-3-phosphate dehydrogenase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6246 | NCLAPLAKVIHDNFGIVEGLMT | Glyceraldehyde-3-phosphate dehydrogenase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6763 | SAPSADAPMFV | Glyceraldehyde-3-phosphate dehydrogenase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6776 | SCTTNCLAPLAKVIHDNFGIVEGLMTTV | Glyceraldehyde-3-phosphate dehydrogenase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7013 | SNASCTTNCLAPLAKVI | Glyceraldehyde-3-phosphate dehydrogenase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7014 | SNASCTTNCLAPLAKVIHDNFGIVEGLMT | Glyceraldehyde-3-phosphate dehydrogenase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7015 | SNASCTTNCLAPLAKVIHDNFGIVEGLMTTV | Glyceraldehyde-3-phosphate dehydrogenase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7086 | SSDFNSDTHSSTFDAGAGI | Glyceraldehyde-3-phosphate dehydrogenase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7087 | SSDFNSDTHSSTFDAGAGIAL | Glyceraldehyde-3-phosphate dehydrogenase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7088 | SSDFNSDTHSSTFDAGAGIALNDHFVKLI | Glyceraldehyde-3-phosphate dehydrogenase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7295 | SWYDNEFGY | Glyceraldehyde-3-phosphate dehydrogenase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7296 | SWYDNEFGYSNR | Glyceraldehyde-3-phosphate dehydrogenase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7297 | SWYDNEFGYSNRV | Glyceraldehyde-3-phosphate dehydrogenase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7298 | SWYDNEFGYSNRVVDLM | Glyceraldehyde-3-phosphate dehydrogenase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7438 | TIFQERDPSKIKWGDAGAEYV | Glyceraldehyde-3-phosphate dehydrogenase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7551 | TNCLAPLAKVIHDNFGIVEGLMT | Glyceraldehyde-3-phosphate dehydrogenase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7790 | VESTGVFTTMEKA | Glyceraldehyde-3-phosphate dehydrogenase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8027 | VTRAAFNSGKVDIVAINDPFIDL | Glyceraldehyde-3-phosphate dehydrogenase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8028 | VTRAAFNSGKVDIVAINDPFIDLNY | Glyceraldehyde-3-phosphate dehydrogenase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8200 | WYDNEFGYSNR | Glyceraldehyde-3-phosphate dehydrogenase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8201 | WYDNEFGYSNRVV | Glyceraldehyde-3-phosphate dehydrogenase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8845 | FRVPTANVSVVD | Glyceraldehyde-3-phosphate dehydrogenase | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8890 | GNPITIFQERDPS | Glyceraldehyde-3-phosphate dehydrogenase | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID10252 | GKVKVGVNGFGRIGRL | Glyceraldehyde-3-phosphate dehydrogenase | Urine | 1656.9544 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11091 | NA | G3P_HUMAN | Urine | 3723.84 | MALDI-TOF | Clear cell renal carcinoma | Downregulated with increse in tumor mass | 26482227 |