Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID4114 | ADRGECVPGEQEPEPI | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4115 | ADRGECVPGEQEPEPIL | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4116 | ADRGECVPGEQEPEPILIPR | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4117 | ADRGECVPGEQEPEPILIPRV | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4206 | AIGSTCPWLKK | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4207 | AIGSTCPWLKKIMDRMTV | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4234 | AKLYGRAPQL | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4331 | AQGVGIPEDSIFT | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4332 | AQGVGIPEDSIFTM | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4333 | AQGVGIPEDSIFTMADRGECVPGEQEPEPILIPR | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4573 | DFRVVAQGVGIPEDSIFTM | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4675 | DRGECVPGEQEPEPILIPR | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4784 | ESYVVHTNYDEYA | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5021 | FRVVAQGVGIPEDS | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5022 | FRVVAQGVGIPEDSI | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5023 | FRVVAQGVGIPEDSIFTM | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5050 | FTMADRGECVPGEQEPEPI | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5173 | GIPEDSIFTM | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5174 | GIPEDSIFTMADRGECVPGEQEPEPI | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5175 | GIPEDSIFTMADRGECVPGEQEPEPIL | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5176 | GIPEDSIFTMADRGECVPGEQEPEPILIPR | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5177 | GIPEDSIFTMADRGECVPGEQEPEPILIPRV | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5298 | GSTCPWLKKIMDRMTV | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5325 | GVGIPEDSIFTMADRGECVPGEQEPEPILIPR | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5396 | HTNYDEYAIFLTK | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5459 | IFTMADRGECVPGEQEPEPILIPR | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5593 | KFSRHHGPTITAKLYGRAPQLRETLL | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5926 | LLQDFRVVAQ | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5927 | LLQDFRVVAQGVGIPEDSIF | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5928 | LLQDFRVVAQGVGIPEDSIFT | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5929 | LLQDFRVVAQGVGIPEDSIFTM | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6003 | LQDFRVVAQG | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6004 | LQDFRVVAQGV | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6005 | LQDFRVVAQGVGIPEDS | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6006 | LQDFRVVAQGVGIPEDSI | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6007 | LQDFRVVAQGVGIPEDSIF | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6008 | LQDFRVVAQGVGIPEDSIFT | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6009 | LQDFRVVAQGVGIPEDSIFTM | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6093 | LTKKFSRHHGPT | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6094 | LTKKFSRHHGPTIT | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6095 | LTKKFSRHHGPTITA | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6096 | LTKKFSRHHGPTITAKL | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6129 | LVLGEGATEAE | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6161 | MADRGECVPGEQEPEPI | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6162 | MADRGECVPGEQEPEPILIPR | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6378 | NYDEYAIFLTK | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6496 | QDFRVVAQGVGIPEDSIF | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6497 | QDFRVVAQGVGIPEDSIFT | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6533 | QGVGIPEDSIFTM | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6633 | QYGGCMGNGNNFVTEKECLQTCRTV | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6651 | RETLLQDFRVVAQGVGIPEDSIFT | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6674 | RHHGPTITAKLYGRAPQLRET | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6728 | RVVAQGVGIPEDSIFTM | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6729 | RVVAQGVGIPEDSIFTMADRGECVPGEQEPEPI | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7065 | SRHHGPTITAKLYGRAPQLRETLL | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7149 | STLVLGEGATEAEI | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7330 | SYVVHTNYDEYA | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7500 | TLLQDFRVVAQGVGIPEDSIFT | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7542 | TMADRGECVPGEQEPEPI | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7543 | TMADRGECVPGEQEPEPILIPR | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7547 | TMESYVVHTNYDEY | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7711 | VAQGVGIPEDSIFTM | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7838 | VGIPEDSIFTMADRGECVPGEQEPEPILIPR | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7893 | VLGEGATEAEI | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7894 | VLGEGATEAEIS | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7895 | VLGEGATEAEISMTST | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8281 | YGRAPQLRETLLQDFRVVAQGVGIPEDSIFT | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8282 | YGRAPQLRETLLQDFRVVAQGVGIPEDSIFTM | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8400 | YVVHTNYDE | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8401 | YVVHTNYDEY | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8402 | YVVHTNYDEYA | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8403 | YVVHTNYDEYAIF | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID9544 | GDEELLRFSN | Protein AMBP | Serum | 590.28 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9545 | GVPGDGDEELLRFSN | Protein AMBP | Serum | 802.88 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9975 | YGRAPQLRE | Protein AMBP | Urine | 1089.568 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID9992 | AKLYGRAPQL | Protein AMBP | Urine | 1116.6341 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID9998 | YVVHTNYDE | Protein AMBP | Urine | 1139.4901 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10026 | YEKTDTDGKF | Protein AMBP | Urine | 1203.5398 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10067 | YGRAPQLRETL | Protein AMBP | Urine | 1303.7053 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10075 | PWLKKIMDRM | Protein AMBP | Urine | 1317.7008 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10080 | RVVAQGVGIPEDS | Protein AMBP | Urine | 1326.6854 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10149 | FRVVAQGVGIPEDS | Protein AMBP | Urine | 1473.7144 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10168 | TKKFSRHHGPTIT | Protein AMBP | Urine | 1509.8135 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10216 | RVVAQGVGIPEDSIF | Protein AMBP | Urine | 1586.8559 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10217 | FRVVAQGVGIPEDSI | Protein AMBP | Urine | 1586.8407 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10231 | LTKKFSRHHGPTIT | Protein AMBP | Urine | 1622.9102 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10269 | RVVAQGVGIPEDSIFT | Protein AMBP | Urine | 1687.8653 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10283 | FRVVAQGVGIPEDSIF | Protein AMBP | Urine | 1733.946 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10311 | FLTKKFSRHHGPTIT | Protein AMBP | Urine | 1769.9639 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10340 | FRVVAQGVGIPEDSIFT | Protein AMBP | Urine | 1834.9608 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10385 | LTKKFSRHHGPTITAKL | Protein AMBP | Urine | 1935.1239 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10400 | FRVVAQGVGIPEDSIFTM | Protein AMBP | Urine | 1965.9974 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10455 | LQDFRVVAQGVGIPEDSIF | Protein AMBP | Urine | 2090.0899 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10693 | LTKKFSRHHGPTITAKLYGRAPQLRETL | Protein AMBP | Urine | 3219.8119 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10740 | FRVVAQG | Protein AMBP | Urine | 776.4269 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10742 | YGRAPQL | Protein AMBP | Urine | 804.424 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11057 | LTKKFSRHHGPTITAKL | AMBP | Serum | 1935.9 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | "Downregulated in ESCC patients vs control with mean intensity in cancer 1018.23 and mean intensity in normal 2,456.36in normal" | 26993605 |
| CancerPDF_ID11416 | EELLRFSN | Protein AMBP | Serum | 1006.5084 | LC-MS | Melanoma | "Present in 3 cancer samples out of 8 cancer samples. ,Present in 1 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID11456 | GDEELLRFSN | Protein AMBP | Serum | 1178.5568 | LC-MS | Melanoma | "Present in 5 cancer samples out of 8 cancer samples. ,Present in 4 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID13327 | GDEELLRFSN | Protein AMBP | Plasma | 1179.565 | ?LC-MS | "Multiple myeloma patients, Acute myeloid leukemia" | NA | 20974924 |
| CancerPDF_ID13804 | GDEELLRFSN | Protein AMBP | Plasma | 1179.565 | ?LC-MS | "Multiple myeloma patients, Acute myeloid leukemia" | NA | 20974924 |