Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID155 | AEIHQSFQHL | "Alpha-1-antichymotrypsin, chain A" | Plasma | NA | MALDI-TOF | Normal | NA | 17269714 |
| CancerPDF_ID156 | MSKVTNPKQA | "Alpha-1-antichymotrypsin, chain B" | Plasma | NA | MALDI-TOF | Normal | NA | 17269714 |
| CancerPDF_ID1964 | DSLEFREIGELYLPK | Alpha-1-antichymotrypsin | Serum | 1807.93562 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1965 | NSPLDEENLTQENQDR | Alpha-1-antichymotrypsin | Serum | 1900.83988 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1966 | HPNSPLDEENLTQENQDR | Alpha-1-antichymotrypsin | Serum | 2134.95155 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1967 | ADLSGITGARNLAVSQVVH | Alpha-1-antichymotrypsin | Serum | 1907.02247 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1968 | LYGSEAFATDFQDSAAAK | Alpha-1-antichymotrypsin | Serum | 1890.86357 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1969 | RLYGSEAFATDFQDSAAA | Alpha-1-antichymotrypsin | Serum | 1918.86972 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1970 | ADLSGITGAR | Alpha-1-antichymotrypsin | Serum | 959.50361 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1971 | NLAVSQVVHK | Alpha-1-antichymotrypsin | Serum | 1093.62439 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1972 | ADLSGITGARNLAVSQVVHK | Alpha-1-antichymotrypsin | Serum | 2035.11744 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID3105 | DSLEFR | Alpha-1-antichymotrypsin | Plasma | 765.3657 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3106 | ADLSGITGAR | Alpha-1-antichymotrypsin | Plasma | 959.5036 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3107 | NLAVSQVVHK | Alpha-1-antichymotrypsin | Plasma | 1093.6244 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3108 | DSLEFREIGELYLPK | Alpha-1-antichymotrypsin | Plasma | 1807.9356 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3109 | NSPLDEENLTQENQDR | Alpha-1-antichymotrypsin | Plasma | 1900.8399 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3110 | RLYGSEAFATDFQDSAAA | Alpha-1-antichymotrypsin | Plasma | 1918.8697 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3111 | ADLSGITGARNLAVSQVVHK | Alpha-1-antichymotrypsin | Plasma | 2035.1174 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3112 | RLYGSEAFATDFQDSAAAK | Alpha-1-antichymotrypsin | Plasma | 2046.9647 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3113 | HPNSPLDEENLTQENQDR | Alpha-1-antichymotrypsin | Plasma | 2134.9516 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3114 | WRDSLEFREIGELYLPK | Alpha-1-antichymotrypsin | Plasma | 2150.116 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID8591 | SALVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNPKQA | Antichymotrypsin | Serum | 4622.49 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8592 | LVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNPKQA | Antichymotrypsin | Serum | 4464.42 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8593 | VETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNPKQA | Antichymotrypsin | Serum | 4351.33 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8594 | LMIIVPTDTQNIFFMSKVTNPKQA | Antichymotrypsin | Serum | 2735.44 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8595 | IIVPTDTQNIFFMSKVTNPKQA | Antichymotrypsin | Serum | 2491.31 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8646 | ALVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNPKQA | Alpha 1 antichymotrypsin peptide ( C terminal fragment of protein AACT) | Cerbrospinal fluid | NA | MALDI-TOF | Glioblastoma (Malignant brain tumor) | Upregulated in cancer as compare to normal control | 19674866 |
| CancerPDF_ID9524 | HPNSPLDEEN | Alpha-1-antichymotrypsin | Serum | 576.26 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9525 | HPNSPLDEENLTQEN | Alpha-1-antichymotrypsin | Serum | 868.87 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9526 | HPNSPLDEENLTQENQ | Alpha-1-antichymotrypsin | Serum | 932.91 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9527 | HPNSPLDEENLTQENQDR | Alpha-1-antichymotrypsin | Serum | 712.64 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9528 | HPNSPLDEENLTQENQDRGT | Alpha-1-antichymotrypsin | Serum | 765.34 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |