|
This page provides comprehensive information about topically administered skin penetrating peptide database TopicalPdb. |
TopicalPdb is the database of topically administered peptides which penetrate through the skin non invasively. It is a manually curated database and holds 657 entries. Data was collected and compiled from research articles. The fields incorporated provide information on (i) diverse chemical modifications, (ii) in vitro/in vivo model systems (iii) different cargoes delivered by TAPs. TopicalPdb covers different types of TAPs that includes linear, cyclic, and TAPs with various non-natural residues. In addition, it provides structural information of TAPs.
Routes of administartion of topical peptides are:
Data was collected by procuring articles from pubmed using key words like "skin penetrating peptides, topical peptides and trandermal peptides in title or abstract. There are a total of 657 entries in the database.
TopicalPdb provides the users a comprehensive information of the TAPs giving details like their sequence, length, origin, chirality, nature, N-terminal modifications, C-terminal modifications, uptake efficiency, uptake mechanism, in vitro/in vivo models systems used for TAP evaluation and various cargoes delivered by TAPs. Also, various tools like BLAST, Smith-waterman, Mapping and alignment have been integrated to make it more user friendly.
| Field Name | Description | Example |
|---|---|---|
| ID | All the topically applied peptides have been assigned a unique id number which is constant throughout the database. | 1002 |
| PMID | It is a PubMed identification number for further reference. | 24842663 |
| YEAR | It is the year of the pubmed publication | 2014 |
| NAME | It represents name of the peptide used in literature. | AAPV |
| LENGTH | It represents length of the peptide. | 4 |
| SEQUENCE | It provides the amino acid sequence of peptide | AAPV |
| N-TERMINAL MODIFICATION | It represents what N-terminal modification does the peptide have. | Acetylation |
| C-TERMINAL MODIFICATION | It represents what C-terminal modification does the peptide have. | Amidation |
| LINEAR/CYCLIC | It represents whether the peptide is linear or cyclic. | Linear |
| CHIRALITY | It represents chirality of the peptide. | L |
| NATURE OF PEPTIDE OR CARGO | This field explains what kind of behaviour does the peptide show in biological conditions. | It fits the P-P1 subsites of elastase and inhibits HNE competitively |
| ORIGIN OF PEPTIDE | It gives information about the origin of peptide based on literature. | Synthetic |
| MECHANISM | This field explains mechanism of action of the peptide | Increased lipophilicity enhances permeation, enantiomeric selectivity is apparent |
| CARGO SEQUENCE OR STRUCTURE | This field conatins sequence and structural information about the cargoes carried by the peptides | CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP |
| NAME OF THE CARGO | This field tells the name of the cargo | Salmon calcitonin |
| ASSAY | This field tells the assay that has been used to conduct the permeation studies of the peptide | Franz diffusion cell, HPLC |
| ENHANCER | This field explains the enhancers used to increase permeability | Propylene glycol |
| PROPERTY OF ENHANCER | It explains the property of enhancer | Enhancer molecule hydrodispersion gel (HDG) used in the formulation applied |
| CONCENTRATION OF PEPTIDE | It tells the concentration of peptide used for studying its effect. | 2 mg in 200 μL of propylene glycol |
| INCUBATION TIME | Represents the time needed to see the effect of peptide. | 24 hours |
| PERMEABILITY | It tells whether the topically applied peptide is permeable into the skin, nose or eye | Yes |
| TISSUE SAMPLE | It tells on which tissue the peptide was applied upon | Skin |
Answer: TopicalPdb is the database of peptides that can be applied topically through dermal, nasal or ocular route.
Q2. Is TopicalPdb a curated database?Answer: Yes, it is a manually curated database and data was collected from research articles.
Q3. How is TopicalPdb different?Answer: TopicalPdb is a unique database comprising of 657 unique peptides which can be applied topically through dermal,occular or nasal route. This database provides comprehensive information about the peptides, which will prove important for the people working in field of drug formulations.
Q4. Does TopicalPdb provide information of chemically modified TAPs?Answer: Yes, TopicalPdb contains information of diverse types of chemical modifications, including end modifications (acylation, amidation) non-natural residues ( beta-alanine) side chain modifications, peptide backbone modifications.
Q5. Does TopicalPdb give information of peptide structures?Answer: Yes, TopicalPdb provides information of predicted secondary and tertiary structures of TAPs including structure of TAPs having D-amino acids and few modified residues like ornithine and beta-alanine.
Q6. Is TopicalPdb website compatible for smartphone?Answer: Yes, we have built user-friendly responsive website, which is compatible for desktop, tablet and smartphone.