Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID70 | ATEHLSTLSEKAKPALEDL | Apolipoprotein A-I | Serum | 2052.89 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID71 | QGLLPVLESFKVSFLSALEEYTKKLNTQ | Apolipoprotein A-I | Serum | 3182.46 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID72 | VSFLSALEEYTKKLNTQ | Apolipoprotein A-I | Serum | 1971.16 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID73 | LSALEEYTKKLNTQ | Apolipoprotein A-I | Serum | 819.35 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID74 | SALEEYTKKLNTQ | Apolipoprotein A-I | Serum | 762.85 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID75 | ALEEYTKKLNTQ | Apolipoprotein A-I | Serum | 719.43 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID76 | ELQEGARQKLHELQE | Apolipoprotein A-I | Serum | 1807.78 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID77 | AELQEGARQKLHELQEKLSPLGEEMRDRA | Apolipoprotein A-I | Serum | 3377.45 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID124 | GKQLNLKL | Apolipoprotein A-I | Plasma | NA | MALDI-TOF | Normal | NA | 17269714 |
| CancerPDF_ID125 | YTKKLNTQ | Apolipoprotein A-I | Plasma | NA | MALDI-TOF | Normal | NA | 17269714 |
| CancerPDF_ID126 | EEYTKKLNTQ | Apolipoprotein A-I | Plasma | NA | MALDI-TOF | Normal | NA | 17269714 |
| CancerPDF_ID127 | LRTHLAPYSDEL | Apolipoprotein A-I | Plasma | NA | MALDI-TOF | Normal | NA | 17269714 |
| CancerPDF_ID270 | VSFLSALEEYTK | Apolipoprotein A-I | Plasma | 693.858 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID271 | SFLSALEEYTK | Apolipoprotein A-I | Plasma | 644.3235 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID272 | SFLSALEEYT | Apolipoprotein A-I | Plasma | 580.276 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID273 | FLSALEEYTK | Apolipoprotein A-I | Plasma | 600.8075 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID274 | LEEYTKKLNTQ | Apolipoprotein A-I | Plasma | 683.861 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID275 | LEDLRQGLLPVLESF | Apolipoprotein A-I | Plasma | 864.977 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID276 | RQGLLPVLESF | Apolipoprotein A-I | Plasma | 629.858 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID277 | QGLLPVLESFKV | Apolipoprotein A-I | Plasma | 665.389 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID278 | QGLLPVLESFK | Apolipoprotein A-I | Plasma | 615.855 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID279 | LLPVLESFK | Apolipoprotein A-I | Plasma | 523.315 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID280 | THLAPYSDELRQR | Apolipoprotein A-I | Plasma | 529.2696667 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID281 | THLAPYSDELR | Apolipoprotein A-I | Plasma | 434.5496667 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID282 | HLAPYSDELR | Apolipoprotein A-I | Plasma | 600.8005 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID283 | HLAPYSDELRQR | Apolipoprotein A-I | Plasma | 495.587 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID284 | LLDNWDSVTSTFSK | Apolipoprotein A-I | Plasma | 806.893 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID285 | DVLKDSGRDYVSQ | Apolipoprotein A-I | Plasma | 494.5746667 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID286 | SEKAKPALEDLR | Apolipoprotein A-I | Plasma | 452.9163333 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID1072 | ATEHLSTLSEKAKPALEDL | Apolipoprotein A-I | Serum | 2052.89 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =105, 306 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1073 | QGLLPVLESFKVSFLSALEEYTKKLNTQ | Apolipoprotein A-I | Serum | 3182.46 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =0.74, 6.36 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1074 | VSFLSALEEYTKKLNTQ | Apolipoprotein A-I | Serum | 1971.16 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1, 641 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1075 | ELQEGARQKLHELQE | Apolipoprotein A-I | Serum | 1807.78 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1076 | AELQEGARQKLHELQEKLSPLGEEMRDRA | Apolipoprotein A-I | Serum | 3377.45 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1556 | ATEHLSTLSEK | Apolipoprotein A-I | Serum | 1214.61428 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1557 | DEPPQSPWDR | Apolipoprotein A-I | Serum | 1225.53637 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1558 | VSFLSALEEYTKKLNTQ | Apolipoprotein A-I | Serum | 1970.03606 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1559 | ATEHLSTLSEKAKPALEDLR | Apolipoprotein A-I | Serum | 2208.17501 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1560 | DEPPQSPWDRVKDLATVYVDVLK | Apolipoprotein A-I | Serum | 2669.37008 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1561 | AHVDALR | Apolipoprotein A-I | Serum | 780.42424 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1562 | AKPALEDLR | Apolipoprotein A-I | Serum | 1011.57129 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1563 | LHELQEKLSPLGEEMRDRA | Apolipoprotein A-I | Serum | 2250.14266 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1564 | AHVDALRTHLAPYSDELRQR | Apolipoprotein A-I | Serum | 2347.21452 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1565 | QGLLPVLESFK | Apolipoprotein A-I | Serum | 1229.70197 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1566 | DSGRDYVSQFEGSALG | Apolipoprotein A-I | Serum | 1686.74854 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1567 | KPALEDLR | Apolipoprotein A-I | Serum | 940.53418 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1568 | AELQEGARQ | Apolipoprotein A-I | Serum | 1000.49377 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1569 | THLAPYSDEL | Apolipoprotein A-I | Serum | 1144.54005 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1570 | THLAPYSDELR | Apolipoprotein A-I | Serum | 1300.64116 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1571 | THLAPYSDELRQ | Apolipoprotein A-I | Serum | 1428.69974 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1572 | RHFWQQDEPPQSPWDR | Apolipoprotein A-I | Serum | 2107.96127 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1573 | LHELQEKLSPLGEEMRDR | Apolipoprotein A-I | Serum | 2179.10555 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1574 | HLAPYSDELRQ | Apolipoprotein A-I | Serum | 1327.65206 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1575 | VEPLRAELQEGARQ | Apolipoprotein A-I | Serum | 1594.84272 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1576 | LAEYHAKATEHLSTLSEK | Apolipoprotein A-I | Serum | 2027.03237 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1577 | QKLHELQEKLSPLGEEMRDR | Apolipoprotein A-I | Serum | 2435.25909 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1578 | SALEEYTKKLNTQ | Apolipoprotein A-I | Serum | 1523.78314 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1579 | QKVEPLRAELQEGA | Apolipoprotein A-I | Serum | 1566.83657 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1580 | DSGRDYVSQFEGSALGK | Apolipoprotein A-I | Serum | 1814.84351 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1581 | RLEALKENGGAR | Apolipoprotein A-I | Serum | 1312.72115 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1582 | LAARLEALKENGGA | Apolipoprotein A-I | Serum | 1411.77833 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1583 | EPPQSPWDR | Apolipoprotein A-I | Serum | 1110.50942 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1584 | WQEEMELYR | Apolipoprotein A-I | Serum | 1282.56522 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1585 | ATEHLSTLSEKAKPALEDL | Apolipoprotein A-I | Serum | 2052.0739 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1586 | QKLHELQEKLSPLGEEMRDRA | Apolipoprotein A-I | Serum | 2506.29621 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1587 | AKVQPYLDDFQK | Apolipoprotein A-I | Serum | 1450.74563 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1588 | DEPPQSPWDRVK | Apolipoprotein A-I | Serum | 1452.69974 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1589 | LLDNWDSVTSTFSK | Apolipoprotein A-I | Serum | 1611.77805 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1590 | QGLLPVLESF | Apolipoprotein A-I | Serum | 1101.60701 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1591 | LHELQEKLSPLGEEM | Apolipoprotein A-I | Serum | 1751.87639 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1592 | VSFLSALEEYT | Apolipoprotein A-I | Serum | 1257.61288 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1593 | VSFLSALEEYTK | Apolipoprotein A-I | Serum | 1385.70785 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1594 | LHELQEKLSPLGEEMR | Apolipoprotein A-I | Serum | 1907.9775 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1595 | DSGRDYVSQFEGSALGKQLNL | Apolipoprotein A-I | Serum | 2283.11314 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1596 | SFLSALEEYTKKLNTQ | Apolipoprotein A-I | Serum | 1870.96764 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1597 | QKVEPLRAELQEGAR | Apolipoprotein A-I | Serum | 1722.93768 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1598 | VEPLRAELQEGA | Apolipoprotein A-I | Serum | 1310.68303 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1599 | LAARLEALKENGGAR | Apolipoprotein A-I | Serum | 1567.87944 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1600 | FLSALEEYTKKLNTQ | Apolipoprotein A-I | Serum | 1783.93562 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1601 | VSFLSALEEYTKKLNT | Apolipoprotein A-I | Serum | 1841.97748 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1602 | DEPPQSPWDRVKDLATVYVDVL | Apolipoprotein A-I | Serum | 2541.27512 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1603 | LAEYHAKATEHLSTLSEKAKPALEDLR | Apolipoprotein A-I | Serum | 3020.5931 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1604 | FWQQDEPPQSPWDR | Apolipoprotein A-I | Serum | 1814.80125 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1605 | HLAPYSDELR | Apolipoprotein A-I | Serum | 1199.59349 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1606 | YSDELRQ | Apolipoprotein A-I | Serum | 909.41921 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1607 | TEHLSTLSEK | Apolipoprotein A-I | Serum | 1143.57717 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1608 | THLAPYSDELRQR | Apolipoprotein A-I | Serum | 1584.80085 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1609 | AELQEGARQK | Apolipoprotein A-I | Serum | 1128.58874 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2435 | ALEDLR | Apolipoprotein A-I | Plasma | 715.3864 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2436 | KPALEDL | Apolipoprotein A-I | Plasma | 784.4331 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2437 | ARAHVDAL | Apolipoprotein A-I | Plasma | 851.4614 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2438 | AKPALEDL | Apolipoprotein A-I | Plasma | 855.4702 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2439 | LAARLEAL | Apolipoprotein A-I | Plasma | 855.5178 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2440 | YLDDFQK | Apolipoprotein A-I | Plasma | 927.4338 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2441 | KPALEDLR | Apolipoprotein A-I | Plasma | 940.5342 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2442 | AELQEGARQ | Apolipoprotein A-I | Plasma | 1000.4938 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2443 | LGEEMRDR | Apolipoprotein A-I | Plasma | 1004.4709 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2444 | ARAHVDALR | Apolipoprotein A-I | Plasma | 1007.5625 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2445 | AKPALEDLR | Apolipoprotein A-I | Plasma | 1011.5713 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2446 | HLAPYSDEL | Apolipoprotein A-I | Plasma | 1043.4924 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2447 | QGLLPVLESF | Apolipoprotein A-I | Plasma | 1101.607 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2448 | VQPYLDDFQ | Apolipoprotein A-I | Plasma | 1123.5186 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2449 | TEHLSTLSEK | Apolipoprotein A-I | Plasma | 1143.5772 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2450 | THLAPYSDEL | Apolipoprotein A-I | Plasma | 1144.54 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2451 | RLEALKENGGA | Apolipoprotein A-I | Plasma | 1156.62 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2452 | SPLGEEMRDR | Apolipoprotein A-I | Plasma | 1188.5557 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2453 | LAPYSDELRQ | Apolipoprotein A-I | Plasma | 1190.5932 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2454 | ATEHLSTLSEK | Apolipoprotein A-I | Plasma | 1214.6143 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2455 | DEPPQSPWDR | Apolipoprotein A-I | Plasma | 1225.5364 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2456 | ARLEALKENGGA | Apolipoprotein A-I | Plasma | 1227.6572 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2457 | QGLLPVLESFK | Apolipoprotein A-I | Plasma | 1229.702 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2458 | DLATVYVDVLK | Apolipoprotein A-I | Plasma | 1234.6809 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2459 | KDLATVYVDVL | Apolipoprotein A-I | Plasma | 1234.6809 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2460 | VQPYLDDFQK | Apolipoprotein A-I | Plasma | 1251.6136 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2461 | VSFLSALEEYT | Apolipoprotein A-I | Plasma | 1257.6129 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2462 | WQEEMELYR | Apolipoprotein A-I | Plasma | 1282.5652 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2463 | AARLEALKENGGA | Apolipoprotein A-I | Plasma | 1298.6943 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2464 | THLAPYSDELR | Apolipoprotein A-I | Plasma | 1300.6412 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2465 | LSPLGEEMRDR | Apolipoprotein A-I | Plasma | 1301.6398 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2466 | VEPLRAELQEGA | Apolipoprotein A-I | Plasma | 1310.683 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2467 | AKVQPYLDDFQ | Apolipoprotein A-I | Plasma | 1322.6507 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2468 | DEPPQSPWDRV | Apolipoprotein A-I | Plasma | 1324.6048 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2469 | HLAPYSDELRQ | Apolipoprotein A-I | Plasma | 1327.6521 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2470 | VKDLATVYVDVL | Apolipoprotein A-I | Plasma | 1333.7493 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2471 | LSPLGEEMRDRA | Apolipoprotein A-I | Plasma | 1372.6769 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2472 | KVQPYLDDFQK | Apolipoprotein A-I | Plasma | 1379.7085 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2473 | ARLEALKENGGAR | Apolipoprotein A-I | Plasma | 1383.7583 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2474 | VSFLSALEEYTK | Apolipoprotein A-I | Plasma | 1385.7078 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2475 | WQEEMELYRQ | Apolipoprotein A-I | Plasma | 1410.6238 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2476 | LAARLEALKENGGA | Apolipoprotein A-I | Plasma | 1411.7783 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2477 | THLAPYSDELRQ | Apolipoprotein A-I | Plasma | 1428.6997 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2478 | KVEPLRAELQEGA | Apolipoprotein A-I | Plasma | 1438.778 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2479 | AKVQPYLDDFQK | Apolipoprotein A-I | Plasma | 1450.7456 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2480 | VKDLATVYVDVLK | Apolipoprotein A-I | Plasma | 1461.8443 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2481 | VEPLRAELQEGAR | Apolipoprotein A-I | Plasma | 1466.7841 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2482 | LLDNWDSVTSTFS | Apolipoprotein A-I | Plasma | 1483.6831 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2483 | HLAPYSDELRQR | Apolipoprotein A-I | Plasma | 1483.7532 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2484 | VSFLSALEEYTKK | Apolipoprotein A-I | Plasma | 1513.8028 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2485 | QKVEPLRAELQEGA | Apolipoprotein A-I | Plasma | 1566.8366 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2486 | LAARLEALKENGGAR | Apolipoprotein A-I | Plasma | 1567.8794 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2487 | AKVQPYLDDFQKK | Apolipoprotein A-I | Plasma | 1578.8406 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2488 | THLAPYSDELRQR | Apolipoprotein A-I | Plasma | 1584.8008 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2489 | VEPLRAELQEGARQ | Apolipoprotein A-I | Plasma | 1594.8427 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2490 | KVEPLRAELQEGAR | Apolipoprotein A-I | Plasma | 1594.8791 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2491 | LLDNWDSVTSTFSK | Apolipoprotein A-I | Plasma | 1611.778 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2492 | DSGRDYVSQFEGSALG | Apolipoprotein A-I | Plasma | 1686.7485 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2493 | QRLAARLEALKENGGA | Apolipoprotein A-I | Plasma | 1695.938 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2494 | QKVEPLRAELQEGAR | Apolipoprotein A-I | Plasma | 1722.9377 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2495 | KVEPLRAELQEGARQ | Apolipoprotein A-I | Plasma | 1722.9377 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2496 | VSFLSALEEYTKKLN | Apolipoprotein A-I | Plasma | 1740.9298 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2497 | LHELQEKLSPLGEEM | Apolipoprotein A-I | Plasma | 1751.8764 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2498 | DSGRDYVSQFEGSALGK | Apolipoprotein A-I | Plasma | 1814.8435 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2499 | VSFLSALEEYTKKLNT | Apolipoprotein A-I | Plasma | 1841.9775 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2500 | EYHAKATEHLSTLSEK | Apolipoprotein A-I | Plasma | 1842.9112 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2501 | QKVEPLRAELQEGARQ | Apolipoprotein A-I | Plasma | 1850.9963 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2502 | QRLAARLEALKENGGAR | Apolipoprotein A-I | Plasma | 1852.0391 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2503 | AHVDALRTHLAPYSDEL | Apolipoprotein A-I | Plasma | 1906.9537 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2504 | LHELQEKLSPLGEEMR | Apolipoprotein A-I | Plasma | 1907.9775 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2505 | VSFLSALEEYTKKLNTQ | Apolipoprotein A-I | Plasma | 1970.0361 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2506 | QKVEPLRAELQEGARQK | Apolipoprotein A-I | Plasma | 1979.0912 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2507 | AELQEGARQKLHELQEK | Apolipoprotein A-I | Plasma | 2006.0545 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2508 | QKLHELQEKLSPLGEEM | Apolipoprotein A-I | Plasma | 2008.0299 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2509 | LAEYHAKATEHLSTLSEK | Apolipoprotein A-I | Plasma | 2027.0324 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2510 | ATEHLSTLSEKAKPALEDL | Apolipoprotein A-I | Plasma | 2052.0739 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2511 | AHVDALRTHLAPYSDELR | Apolipoprotein A-I | Plasma | 2063.0548 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2512 | QLNLKLLDNWDSVTSTFS | Apolipoprotein A-I | Plasma | 2080.0477 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2513 | RHFWQQDEPPQSPWDR | Apolipoprotein A-I | Plasma | 2107.9613 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2514 | QKLHELQEKLSPLGEEMR | Apolipoprotein A-I | Plasma | 2164.131 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2515 | LHELQEKLSPLGEEMRDR | Apolipoprotein A-I | Plasma | 2179.1056 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2516 | LHELQEKLSPLGEEMRDR | Apolipoprotein A-I | Plasma | 2195.1005 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2517 | LREQLGPVTQEFWDNLEK | Apolipoprotein A-I | Plasma | 2201.1117 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2518 | QLNLKLLDNWDSVTSTFSK | Apolipoprotein A-I | Plasma | 2208.1426 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2519 | ATEHLSTLSEKAKPALEDLR | Apolipoprotein A-I | Plasma | 2208.175 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2520 | AKPALEDLRQGLLPVLESFK | Apolipoprotein A-I | Plasma | 2223.2627 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2521 | LHELQEKLSPLGEEMRDRA | Apolipoprotein A-I | Plasma | 2250.1427 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2522 | LAARLEALKENGGARLAEYHA | Apolipoprotein A-I | Plasma | 2252.2026 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2523 | LHELQEKLSPLGEEMRDRA | Apolipoprotein A-I | Plasma | 2266.1376 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2524 | DSGRDYVSQFEGSALGKQLNL | Apolipoprotein A-I | Plasma | 2283.1131 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2525 | ARAHVDALRTHLAPYSDELR | Apolipoprotein A-I | Plasma | 2290.1931 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2526 | AHVDALRTHLAPYSDELRQR | Apolipoprotein A-I | Plasma | 2347.2145 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2527 | LHELQEKLSPLGEEMRDRAR | Apolipoprotein A-I | Plasma | 2406.2438 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2528 | DSGRDYVSQFEGSALGKQLNLK | Apolipoprotein A-I | Plasma | 2411.2081 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2529 | THLAPYSDELRQRLAARLEAL | Apolipoprotein A-I | Plasma | 2422.3081 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2530 | QKLHELQEKLSPLGEEMRDR | Apolipoprotein A-I | Plasma | 2435.2591 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2531 | QKLHELQEKLSPLGEEMRDRA | Apolipoprotein A-I | Plasma | 2506.2962 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2532 | AKVQPYLDDFQKKWQEEMEL | Apolipoprotein A-I | Plasma | 2524.2308 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2533 | ENGGARLAEYHAKATEHLSTLSEK | Apolipoprotein A-I | Plasma | 2611.299 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2534 | VQPYLDDFQKKWQEEMELYR | Apolipoprotein A-I | Plasma | 2644.2632 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2535 | QKLHELQEKLSPLGEEMRDRAR | Apolipoprotein A-I | Plasma | 2662.3973 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2536 | VQPYLDDFQKKWQEEMELYRQ | Apolipoprotein A-I | Plasma | 2772.3218 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2537 | AKVQPYLDDFQKKWQEEMELYR | Apolipoprotein A-I | Plasma | 2843.3952 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2538 | AELQEGARQKLHELQEKLSPLGEEM | Apolipoprotein A-I | Plasma | 2862.4546 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2539 | LAEYHAKATEHLSTLSEKAKPALEDL | Apolipoprotein A-I | Plasma | 2864.492 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2540 | LREQLGPVTQEFWDNLEKETEGLR | Apolipoprotein A-I | Plasma | 2886.4512 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2541 | AKVQPYLDDFQKKWQEEMELYRQ | Apolipoprotein A-I | Plasma | 2971.4538 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2542 | THLAPYSDELRQRLAARLEALKENGGA | Apolipoprotein A-I | Plasma | 2978.5686 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2543 | VKDLATVYVDVLKDSGRDYVSQFEGSALG | Apolipoprotein A-I | Plasma | 3130.5823 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2544 | AELQEGARQKLHELQEKLSPLGEEMRDR | Apolipoprotein A-I | Plasma | 3289.6837 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2545 | ATEHLSTLSEKAKPALEDLRQGLLPVLESF | Apolipoprotein A-I | Plasma | 3291.7715 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2546 | LREQLGPVTQEFWDNLEKETEGLRQEMS | Apolipoprotein A-I | Plasma | 3361.6249 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2547 | ATEHLSTLSEKAKPALEDLRQGLLPVLESFK | Apolipoprotein A-I | Plasma | 3419.8664 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2548 | LREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEV | Apolipoprotein A-I | Plasma | 4074.9844 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2549 | LREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVK | Apolipoprotein A-I | Plasma | 4203.0794 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3424 | LSALEEYTKK | Apolipoprotein A-I | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3432 | EEYTKKLNTQ | Apolipoprotein A-I | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3442 | ALEEYTKKLNTQ | Apolipoprotein A-I | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3469 | DEPPQSPWDRVKDLAT | Apolipoprotein A-I | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3477 | AARLEALKENGGARLAEY | Apolipoprotein A-I | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3482 | DEPPQSPWDRVKDLATVY | Apolipoprotein A-I | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3545 | LSALEEYTKK | Apolipoprotein A-I | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3554 | EEYTKKLNTQ | Apolipoprotein A-I | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3577 | ALEEYTKKLNTQ | Apolipoprotein A-I | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3578 | GLpGTGGPpGENGKpG | Collagen alpha1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3581 | DEPPQSPWDRVK | Apolipoprotein A-I | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3599 | DEPPQSPWDRVKD | Apolipoprotein A-I | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3615 | LSALEEYTKKLNTQ | Apolipoprotein A-I | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3664 | DEPPQSPWDRVKDLAT | Apolipoprotein A-I | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3682 | AARLEALKENGGARLAEY | Apolipoprotein A-I | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3709 | DEPPQSPWDRVKDLATVY | Apolipoprotein A-I | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID4235 | AKPALEDLRQGLLPVLESFKV | Apolipoprotein A-I | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4561 | DEPPQSPWDRVKDLATVYVDV | Apolipoprotein A-I | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4642 | DLRQGLLPVLESF | Apolipoprotein A-I | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4664 | DNWDSVTSTFSKL | Apolipoprotein A-I | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4665 | DNWDSVTSTFSKLREQLGPV | Apolipoprotein A-I | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4666 | DNWDSVTSTFSKLREQLGPVTQ | Apolipoprotein A-I | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4667 | DNWDSVTSTFSKLREQLGPVTQEF | Apolipoprotein A-I | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5734 | LDNWDSVTSTFSKL | Apolipoprotein A-I | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5735 | LDNWDSVTSTFSKLREQLGPVTQEF | Apolipoprotein A-I | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6048 | LSALEEYTKKLNTQ | Apolipoprotein A-I | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6062 | LSEKAKPALEDLRQG | Apolipoprotein A-I | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6650 | REQLGPVTQEF | Apolipoprotein A-I | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6796 | SEKAKPALEDLRQGLLPV | Apolipoprotein A-I | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6797 | SEKAKPALEDLRQGLLPVLESFKV | Apolipoprotein A-I | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6816 | SFLSALEEYTKKL | Apolipoprotein A-I | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6817 | SFLSALEEYTKKLNTQ | Apolipoprotein A-I | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7048 | SQFEGSALGKQLNLKL | Apolipoprotein A-I | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7577 | TSTFSKLREQLGPVTQEF | Apolipoprotein A-I | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7766 | VDVLKDSGRDYVSQ | Apolipoprotein A-I | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7767 | VDVLKDSGRDYVSQF | Apolipoprotein A-I | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7768 | VDVLKDSGRDYVSQFEG | Apolipoprotein A-I | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7769 | VDVLKDSGRDYVSQFEGSAL | Apolipoprotein A-I | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8126 | WDNLEKETEGL | Apolipoprotein A-I | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8127 | WDNLEKETEGLRQE | Apolipoprotein A-I | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8128 | WDNLEKETEGLRQEM | Apolipoprotein A-I | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8392 | YVDVLKDSGRDYV | Apolipoprotein A-I | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8578 | AELQEGARQKLHELQEKLSPLGEEMRDRA | Aplipoprotein A-I | Serum | 3374.74 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8579 | QGLLPVLESFKVSFLSALEEYTKKLNTQ | Aplipoprotein A-I | Serum | 3181.73 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8580 | ATEHLSTLSEKAKPALEDL | Aplipoprotein A-I | Serum | 2052.07 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8696 | AKVQPYLDD | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8697 | AKVQPYLDDF | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8719 | ATVYVDVLKDS | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8740 | DDFQKKWQEEME | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8757 | DLATVYVDVLKDSGRDY | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8764 | DNENVVNEY | Fibrinogen beta chain | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8765 | DNWDSVTST | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8766 | DNWDSVTSTF | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8767 | DNWDSVTSTFS | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8768 | DNWDSVTSTFSKL | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8779 | DVLKDSGRDYV | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8787 | EFWDNLEKETEG | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8794 | EKLSPLGEEM | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8795 | EKLSPLGEEMRD | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8799 | ELQEKLSPLGEEMRD | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8803 | ENGGARLAEY | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8808 | EQLGPVTQEF | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8809 | EQLGPVTQEFWD | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8810 | EQLGPVTQEFWDNLE | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8811 | EQLGPVTQEFWDNLEK | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8859 | FWDNLEKETEG | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8900 | GPVTQEFWDNLE | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8901 | GPVTQEFWDNLEK | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8930 | HELQEKLSPLGEEM | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8931 | HELQEKLSPLGEEMRD | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8941 | HLSFLEKDL | Apolipoprotein A-IV | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9008 | KVQPYLDDF | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9010 | LDDFQKKW | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9012 | LDNWDSVTST | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9013 | LDNWDSVTSTF | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9014 | LDNWDSVTSTFS | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9022 | LGPVTQEFWDNLE | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9023 | LGPVTQEFWDNLEK | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9024 | LGPVTQEFWDNLEKETEG | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9035 | LLDNWDSVTS | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9036 | LLDNWDSVTSTF | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9058 | LSTLSEKAKPALED | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9082 | NALFQDKLGEVNTYAGDL | Apolipoprotein A-IV | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9104 | NLKLLDNWD | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9105 | NLKLLDNWDS | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9158 | QEFWDNLEKETEG | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9160 | QEKLSPLGEEM | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9161 | QEKLSPLGEEMRD | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9173 | QKKWQEEMEL | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9174 | QKKWQEEMELY | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9175 | QKLHELQEKLSPLGEEMRD | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9177 | QKVEPLRAEL | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9178 | QKVEPLRAELQE | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9179 | QKVEPLRAELQEG | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9209 | REQLGPVTQEF | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9325 | TQEFWDNLE | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9350 | TVYVDVLKD | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9357 | VDVLKDSGRDYVS | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9358 | VDVLKDSGRDYVSQ | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9411 | VTQEFWDNLE | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9412 | VTQEFWDNLEK | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9423 | VYVDVLKDS | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9424 | VYVDVLKDSGRDY | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9425 | VYVDVLKDSGRDYVS | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9426 | WDNLEKETEG | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9445 | YVDVLKDSGRDYVS | Apolipoprotein A-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9547 | SALEEYTKKLNTQ | Apolipoprotein A-I | Serum | 508.93 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9548 | VSFLSALEEYTKKLNTQ | Apolipoprotein A-I | Serum | 657.68 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9549 | ATEHLSTLSEKAKPALEDL | Apolipoprotein A-I | Serum | 685.03 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9550 | AELQEGARQKLHELQEKLSPLGEEMRD | Apolipoprotein A-I | Serum | 784.41 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9551 | AELQEGARQKLHELQEKLSPLGEEMRDRA | Apolipoprotein A-I | Serum | 841.19 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9552 | EEYTKKLNTQ | Apolipoprotein A-I | Serum | 627.34 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9553 | VSFLSALEEYTKKLNT | Apolipoprotein A-I | Serum | 615 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID10054 | FKVSFLSALEE | Apolipoprotein A-I | Urine | 1269.6725 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10065 | LRTHLAPYSDE | Apolipoprotein A-I | Urine | 1301.6382 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10111 | LRTHLAPYSDEL | Apolipoprotein A-I | Urine | 1414.719 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10205 | DEPPQSPWDRVKD | Apolipoprotein A-I | Urine | 1568.7118 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10206 | AARLEALKENGGARL | Apolipoprotein A-I | Urine | 1568.8862 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10207 | AEYHAKATEHLSTL | Apolipoprotein A-I | Urine | 1570.7897 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10239 | LSALEEYTKKLNTQ | Apolipoprotein A-I | Urine | 1637.8575 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10263 | DEPPQSPWDRVKDL | Apolipoprotein A-I | Urine | 1681.8205 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10304 | SEKAKPALEDLRQGLL | Apolipoprotein A-I | Urine | 1767.9961 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10352 | DEPPQSPWDRVKDLAT | Apolipoprotein A-I | Urine | 1853.9034 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10403 | LRTHLAPYSDELRQRL | Apolipoprotein A-I | Urine | 1968.0614 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10450 | SEKAKPALEDLRQGLLPVL | Apolipoprotein A-I | Urine | 2077.1948 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10467 | DEPPQSPWDRVKDLATVY | Apolipoprotein A-I | Urine | 2116.0234 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10562 | LRTHLAPYSDELRQRLAARL | Apolipoprotein A-I | Urine | 2379.3258 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10629 | EALKENGGARLAEYHAKATEHLSTL | Apolipoprotein A-I | Urine | 2709.3978 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10699 | AEYHAKATEHLSTLSEKAKPALEDLRQGLL | Apolipoprotein A-I | Urine | 3319.7917 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10718 | AEYHAKATEHLSTLSEKAKPALEDLRQGLLPVL | Apolipoprotein A-I | Urine | 3629.0153 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10725 | AEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLES | Apolipoprotein A-I | Urine | 3845.1017 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10736 | FKVSFL | Apolipoprotein A-I | Urine | 740.4406 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10758 | ESFKVSFL | Apolipoprotein A-I | Urine | 956.5084 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11724 | KATEHLSTL | Apolipoprotein A-I | Serum | 998.53966 | LC-MS | Melanoma | "Present in 4 cancer samples out of 8 cancer samples. ,Present in 2 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID12676 | QGLLPVLESFKVSFLSALEEYTKKLNTQ | Apolipoprotein A-I | Serum | NA | LC-MS | Renal cell carcinaoma | Upregulated in cancer v/s Normal | 25168216 |
| CancerPDF_ID12693 | VSFLSALEEYTKKLNTQ | Apolipoprotein A-I | Serum | 1970.984 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.57 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.88, Upregulated in BC vs healthy with 0.925 fold change" | 27058005 |