Browse result page of AntiTbPdb
The total number entries retrieved from this search are 112
ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
antitb_1132 | Human neutrophil defensin (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Internal disulphide bond (cys2-cys30, cys4-cys19,cys9-cys29) | Cyclic | 30 | L | Cationic | Protein Derived | From the human defensin protein found in granules of neutrophils. | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv (ATCC 25618) | 50 mg/L causes approx 70 % growth inhibition | In vitro | None | NA | NA | None | NA | NA | Disrupt the membrane architecture | Cell envelope | None | Antibacterial against salmonella, staphylococcus and neisseria | 2001 | 11328767 |
antitb_1133 | Human neutrophil defensin (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Internal disulphide bond (cys2-cys30, cys4-cys19,cys9-cys29) | Cyclic | 30 | L | Cationic | Protein Derived | From the human defensin protein found in granules of neutrophils. | Mycobacterium tuberculosis | Mycobacterium tuberculosis E1380/94 MDR (Isoniazid, rifampicin, streptomycin, ethambutol) strain | 50 mg/L causes approx 30 % growth inhibition | In vitro | None | NA | NA | None | NA | NA | Disrupt the membrane architecture | Cell envelope | None | Antibacterial against salmonella, staphylococcus and neisseria | 2001 | 11328767 |
antitb_1136 | NK-2 | KILRGVCKKIMRTFLRRISKDILTGKK | Free | Amidation | None | Linear | 27 | L | Cationic | Protein Derived | Core region of the lymphocytic effector protein NK-lysin, found in NK cells and cytotoxic T cells | Mycobacterium smegmatis | Mycobacterium smegmatis mc2155 (ATCC 700084) | 17.5 μg of NK-2/ml killed >90% M. smegmatis population after 24 h of incubation | In vitro | RAW264.7 | No significant reduction in intracellular survival of M. smegmatis was observed | No significant reduction in cell viability upto 100 μg/ml | None | NA | NA | Permeabilization of the bacterial cell membrane | Cell envelope | None | Antibacterial, Antiprotozoan (Trypanosoma cruzi and Plasmodium falciparum) and antifungal (Candida albicans) | 2013 | 23689720 |
antitb_1137 | NK-2 | KILRGVCKKIMRTFLRRISKDILTGKK | Free | Amidation | None | Linear | 27 | L | Cationic | Protein Derived | Core region of the lymphocytic effector protein NK-lysin, found in NK cells and cytotoxic T cells | Mycobacterium smegmatis | Mycobacterium smegmatis mc2155 (ATCC 700084) | 7 μg of NK- 2/ml combined with 0.5 ppm of NP-1 kills 90% of M. smegmatis | In vitro | RAW264.7 | Combination of NP-1 and NK-2 showed 35% reduction in intracellular survival of M. smegmatis | No significant reduction in cell viability either treating alone or combination | None | NA | NA | Permeabilization of the bacterial cell membrane | Cell envelope | AgNPs synthesiszed only in the presence of a plant Alstonia macrophylla (NP-1). | Antibacterial, Antiprotozoan (Trypanosoma cruzi and Plasmodium falciparum) and antifungal (Candida albicans) | 2013 | 23689720 |
antitb_1138 | NK-2 | KILRGVCKKIMRTFLRRISKDILTGKK | Free | Amidation | None | Linear | 27 | L | Cationic | Protein Derived | Core region of the lymphocytic effector protein NK-lysin, found in NK cells and cytotoxic T cells | Mycobacterium smegmatis | Mycobacterium smegmatis mc2155 (ATCC 700084) | 7 μg of NK- 2/ml combined with 0.5 ppm of NP-2 kills 90% of M. smegmatis | In vitro | RAW264.7 | NP-2 in combination with NK-2 killed >52% intra- cellular M. smegmatis. | No significant reduction in cell viability either treating alone or combination | None | NA | NA | Permeabilization of the bacterial cell membrane | Cell envelope | AgNPs synthesiszed only in the presence of a fungal Trichoderma sp. (NP-2). | Antibacterial, Antiprotozoan (Trypanosoma cruzi and Plasmodium falciparum) and antifungal (Candida albicans) | 2013 | 23689720 |
antitb_1139 | NK-2 | KILRGVCKKIMRTFLRRISKDILTGKK | Free | Amidation | None | Linear | 27 | L | Cationic | Protein Derived | Core region of the lymphocytic effector protein NK-lysin, found in NK cells and cytotoxic T cells | Mycobacterium marinum | Mycobacterium marinum (ATCC 927) | IC90 = 3.5 μg/ml | In vitro | RAW264.7 | Moderate killing was observed | No significant reduction in cell viability either treating alone or combination | None | NA | NA | Permeabilization of the bacterial cell membrane | Cell envelope | None | Antibacterial, Antiprotozoan (Trypanosoma cruzi and Plasmodium falciparum) and antifungal (Candida albicans) | 2013 | 23689720 |
antitb_1140 | LLKKK-18 | KEFKRIVKRIKKFLRKL | Free | Free | None | Linear | 17 | L | Amphipathic | Protein Derived | Variant of LL-37 | Mycobacterium smegmatis | Mycobacterium smegmatis mc2155 (ATCC 700084) | 25 μg of LLKKK-18/ml killed >80% of M. smegmatis after 24 h | In vitro | RAW264.7 | No significant reduction in intracellular survival of M. smegmatis was observed | No significant reduction in cell viability upto 25 μg/ml | None | NA | NA | Permeabilization of the bacterial cell membrane | Cell envelope | None | None | 2013 | 23689720 |
antitb_1141 | LLKKK-18 | KEFKRIVKRIKKFLRKL | Free | Free | None | Linear | 17 | L | Amphipathic | Protein Derived | Variant of LL-38 | Mycobacterium smegmatis | Mycobacterium smegmatis mc2155 (ATCC 700084) | 0.5 ppm of NP-1 combined with 1 μg/ml of LLKKK-18 kills 50% of M. smegmatis | In vitro | RAW264.7 | NP-1 in combination with LLKKK-18 kills 65% of mycobacteria compared to NP-1 or LLKKK-18 alone. | No significant reduction in cell viability either treating alone or combination | None | NA | NA | Permeabilization of the bacterial cell membrane | Cell envelope | AgNPs synthesiszed only in the presence of a plant Alstonia macrophylla (NP-1). | None | 2013 | 23689720 |
antitb_1142 | LLKKK-18 | KEFKRIVKRIKKFLRKL | Free | Free | None | Linear | 17 | L | Amphipathic | Protein Derived | Variant of LL-39 | Mycobacterium smegmatis | Mycobacterium smegmatis mc2155 (ATCC 700084) | 0.5 ppm of NP-2 combined with 1 μg/ml of LLKKK-18 kills 89% of M. smegmatis | In vitro | RAW264.7 | No significant reduction | No significant reduction in cell viability either treating alone or combination | None | NA | NA | Permeabilization of the bacterial cell membrane | Cell envelope | AgNPs synthesiszed only in the presence of a fungal Trichoderma sp. (NP-2). | None | 2013 | 23689720 |
antitb_1143 | LLKKK-18 | KEFKRIVKRIKKFLRKL | Free | Free | None | Linear | 17 | L | Amphipathic | Protein Derived | Variant of LL-40 | Mycobacterium marinum | Mycobacterium marinum (ATCC 927) | IC 90 = 1 μg/ml | In vitro | RAW264.7 | Moderate killing was observed | No significant reduction in cell viability either treating alone or combination | None | NA | NA | Permeabilization of the bacterial cell membrane | Cell envelope | None | None | 2013 | 23689720 |
antitb_1164 | hLFcin1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Protein Derived | From human lactoferrin | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC50 = 15.8 ± 4.5 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
antitb_1165 | hLFcin1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Protein Derived | From human lactoferrin | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC90 =34.6 ± 22.4 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
antitb_1166 | hLFcin1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Protein Derived | From human lactoferrin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth transparent variant (SmT) | IC50 = 11.0 ± 4.1 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
antitb_1167 | hLFcin1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Protein Derived | From human lactoferrin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth transparent variant (SmT) | IC90 = 65.8 ± 19.3 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
antitb_1168 | hLFcin1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Protein Derived | From human lactoferrin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth doomed variant (SmD) | IC50 = 15.2 ± 2.9 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
antitb_1169 | hLFcin1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Protein Derived | From human lactoferrin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth doomed variant (SmD) | IC90 =37.9 ± 15.9 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
antitb_1171 | LFcin17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Protein Derived | From bovine lactoferricin | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC50 = 14.2 ± 1.5 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
antitb_1172 | LFcin17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Protein Derived | From bovine lactoferricin | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC90 = 18.9 ± 4.0 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
antitb_1173 | LFcin17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Protein Derived | From bovine lactoferricin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth transparent variant (SmT) | IC50 = 8.0 ± 1.5 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
antitb_1174 | LFcin17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Protein Derived | From bovine lactoferricin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth transparent variant (SmT) | IC90 = 22.8 ± 9.1 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
antitb_1175 | LFcin17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Protein Derived | From bovine lactoferricin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth doomed variant (SmD) | IC50 = 12.4 ± 0.3 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
antitb_1176 | LFcin17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Protein Derived | From bovine lactoferricin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth doomed variant (SmD) | IC90 = 21.5 ± 4.0 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
antitb_1222 | Peptide | SEFAYGSFVRTVSLPV | Conjugated with INH | Free | Conjugated with INH at N-terminal | Linear | 16 | L | NA | Protein Derived | 91−106 region of the heat shock protein (Hsp16.3) | None | None | NA | NA | NA | NA | NA | NA | NA | NA | Interact with Phospholipid Langmuir Monolayers and enhnaces the cell permating abiloity of INH | Phospholipid Langmuir Monolayers | Isoniazide (INH) | None | 2013 | 23679078 |
antitb_1223 | Human neutrophil peptide 1 (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulfide bridge: 2-30, 4-19, 9-29 | Cyclic | 30 | L | NA | Protein Derived | Human neutrophil | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | 96.5 % inhibition at 10 μg/ml | In vitro | THP-1 cells | Significant reduction in CFU | NA | None | NA | NA | NA | NA | None | None | 2013 | 23827033 |
antitb_1224 | Human neutrophil peptide 1 (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulfide bridge: 2-30, 4-19, 9-30 | Cyclic | 30 | L | NA | Protein Derived | Human neutrophil | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | 98.3 % inhibition at 15 μg/ml | In vitro | THP-1 cells | Significant reduction in CFU | NA | None | NA | NA | NA | NA | None | None | 2013 | 23827033 |
antitb_1225 | Human neutrophil peptide 1 (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulfide bridge: 2-30, 4-19, 9-31 | Cyclic | 30 | L | NA | Protein Derived | Human neutrophil | Mycobacterium tuberculosis | 36 Clinical isolates of Mycobacterium tuberculosis | 11 isolates (31%) showed greater sensitivity to HNP-1 than H37Rv strains. At 15 μg/ml, they wer completely inhibited. | In vitro | THP-1 cells | Sixteen clinical isolates had lower intracellular growth ability than the H37Rv strain. | NA | None | NA | NA | NA | NA | None | None | 2013 | 23827033 |
antitb_1226 | Human neutrophil peptide 1 (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulfide bridge: 2-30, 4-19, 9-32 | Cyclic | 30 | L | NA | Protein Derived | Human neutrophil | Mycobacterium bovis | Mycobacterium bovis BCG | 99.6 % inhibition at 10 μg/ml | In vitro | THP-1 cells | Significant reduction in CFU | NA | None | NA | NA | NA | NA | None | None | 2013 | 23827033 |
antitb_1227 | Human neutrophil peptide 1 (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulfide bridge: 2-30, 4-19, 9-33 | Cyclic | 30 | L | NA | Protein Derived | Human neutrophil | Mycobacterium bovis | Mycobacterium bovis BCG | 100 % inhibition at 10 μg/ml | In vitro | THP-1 cells | Significant reduction in CFU | NA | None | NA | NA | NA | NA | None | None | 2013 | 23827033 |
antitb_1228 | High Activity Binding Peptides (HABPs) | TGMAALEQYLGSGHAVIVSI | Free | Free | None | Linear | 20 | L | NA | Protein Derived | From Rv1268c protein | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | NA | In vitro | alveolar epithelial cells A549 (ATCC No. CCL-185) | Inhibited mycobacterial entry by up to 65%. | NA | None | NA | NA | Inhibit mycobacterial entry into cells | NA | None | None | 2013 | 23993672 |
antitb_1229 | High Activity Binding Peptides (HABPs) | AVALGLASPADAAAGTMYGD | Free | Free | None | Linear | 20 | L | NA | Protein Derived | From Rv1268c protein | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | NA | In vitro | U937 monocyte derived macrophages (ATCC No. CRL-1593.2) | Inhibited mycobacterial entry by up to 65%. | NA | None | NA | NA | Inhibit mycobacterial entry into cells | NA | None | None | 2013 | 23993672 |
antitb_1260 | RN3 (1-45) | RPPQFTRAQWFAIQHISLNPPRSTIAMRAINNYRWRSKNQNTFLR | Free | Free | None | Linear | 45 | L | Cationic | Protein Derived | From the N terminus of RNase 3 | Mycobacterium vaccae | Mycobacterium vaccae strain (ATCC 15483) | MIC = 10.0 ± 0.5 μM | In vitro | None | NA | NA | None | NA | NA | Membrane depolarization and permeabilization | Cell envelope | None | Antibacterial and Antiparasitic | 2013 | 23716047 |
antitb_1261 | RN3 (1-45) | RPPQFTRAQWFAIQHISLNPPRSTIAMRAINNYRWRSKNQNTFLR | Free | Free | None | Linear | 45 | L | Cationic | Protein Derived | From the N terminus of RNase 4 | Mycobacterium vaccae | Mycobacterium vaccae strain (ATCC 15483) | IC50 = 4.2 ± 0.2 μM | In vitro | None | NA | NA | None | NA | NA | Membrane depolarization and permeabilization | Cell envelope | None | Antibacterial and Antiparasitic | 2013 | 23716047 |
antitb_1262 | RN7 (1-45) | KPKGMTSSQWFKIQHMQPSPQASNSAMKNINKHTKRSKDLNTFLH | Free | Free | None | Linear | 45 | L | Cationic | Protein Derived | From the N terminus of RNase 7 | Mycobacterium vaccae | Mycobacterium vaccae strain (ATCC 15483) | MIC = 20.0 ± 0.8 μM | In vitro | None | NA | NA | None | NA | NA | Membrane depolarization and permeabilization | Cell envelope | None | Antibacterial and Antiparasitic | 2013 | 23716047 |
antitb_1263 | RN7 (1-45) | KPKGMTSSQWFKIQHMQPSPQASNSAMKNINKHTKRSKDLNTFLH | Free | Free | None | Linear | 45 | L | Cationic | Protein Derived | From the N terminus of RNase 8 | Mycobacterium vaccae | Mycobacterium vaccae strain (ATCC 15483) | IC50 = 9.5 ± 0.3 μM | In vitro | None | NA | NA | None | NA | NA | Membrane depolarization and permeabilization | Cell envelope | None | Antibacterial and Antiparasitic | 2013 | 23716047 |
antitb_1264 | Cecropin A-melittin (CA-M) hybrid peptide | KWKLFKKIGIGAVLKVLTTGLPALIS | Free | Amidation | None | Linear | 26 | L | Cationic | Protein Derived | Hybrid derived from cecropin A-melittin | Mycobacterium vaccae | Mycobacterium vaccae strain (ATCC 15483) | MIC = 20.0 ± 1.0 μM | In vitro | None | NA | NA | None | NA | NA | Membrane depolarization and permeabilization | Cell envelope | None | Antibacterial and Antiparasitic | 2013 | 23716047 |
antitb_1265 | Cecropin A-melittin (CA-M) hybrid peptide | KWKLFKKIGIGAVLKVLTTGLPALIS | Free | Amidation | None | Linear | 26 | L | Cationic | Protein Derived | Hybrid derived from cecropin A-melittin | Mycobacterium vaccae | Mycobacterium vaccae strain (ATCC 15483) | IC50 = 10.3 ± 0.3 μM | In vitro | None | NA | NA | None | NA | NA | Membrane depolarization and permeabilization | Cell envelope | None | Antibacterial and Antiparasitic | 2013 | 23716047 |
antitb_1266 | F91 | SEFAYGSFVRTVSLPVGADE | Free | Free | None | Linear | 20 | L | NA | Protein Derived | From 16kDa antigen | None | None | NA | In vivo | NA | NA | NA | Female BALB/c mice (6-8 wk, 20±2 g) | 20 nmol | It promotes the maturation of MHC-II and elicit secretion of IFN-Υ and also induce the expression of CD80, CD86 and CD40 co-stimulatory molecules and activate DCs to produce IL-6 and IL-12. | NA | NA | None | NA | 2013 | 24434326 |
antitb_1267 | L91 | SEFAYGSFVRTVSLPVGADE | Free | Free | Conjugated to TLR2-ligand Pam2Cys | Linear | 20 | L | NA | Protein Derived | From 16kDa antigen | None | None | NA | In vivo | NA | NA | NA | Female BALB/c mice (6-8 wk, 20±2 g) | 20 nmol | It promotes the maturation of MHC-II and elicit secretion of IFN-Υ and also induce the expression of CD80, CD86 and CD40 co-stimulatory molecules and activate DCs to produce IL-6 and IL-12. | NA | NA | None | NA | 2013 | 24434326 |
antitb_1268 | VapB30 (52-59) | ELAAIRHR | Free | Free | None | Linear | 8 | L | NA | Protein Derived | From VapB30 toxin | Mycobacterium tuberculosis | Mycobacterium tuberculosis (strain H37Rv) | NA | NA | NA | NA | NA | None | NA | NA | By disrupting the toxin-antitoxin complex (VapBC) | VapBC | None | NA | 2015 | 26150422 |
antitb_1269 | VapC30 (14-30) | DEPDAERFEAAVEADHI | Free | Free | None | Linear | 17 | L | NA | Protein Derived | From VapC30 toxin | Mycobacterium tuberculosis | Mycobacterium tuberculosis (strain H37Rv) | NA | NA | NA | NA | NA | None | NA | NA | By disrupting the toxin-antitoxin complex (VapBC) | VapBC | None | NA | 2015 | 26150422 |
antitb_1270 | VapC30 (48-56) | RFGEPGGRE | Free | Free | None | Linear | 9 | L | NA | Protein Derived | From VapC30 toxin | Mycobacterium tuberculosis | Mycobacterium tuberculosis (strain H37Rv) | NA | NA | NA | NA | NA | None | NA | NA | By disrupting the toxin-antitoxin complex (VapBC) | VapBC | None | NA | 2015 | 26150422 |
antitb_1330 | Human beta casein fragment (54-59) | VEPIPY | Free | Free | None | Linear | 6 | L | Cationic | Protein derived | Human beta casein protein | Mycobacterium bovis | Mycobacterium bovis BCG | MIC = 25μM | in vitro | THP 1 cell lines | Cells treated with 10 mM and 20 mM peptide showed 17.13% and 29.56% increase in clearance of BCG | NA | NA | NA | Increase expression of IL-8, MCP-1, MIP-1β, TNF-α | NA | NA | NA | NA | 2012 | 23029305 |
antitb_1439 | A2-TB10.4 | IMYNYPAML | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein TB10.4 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
antitb_1440 | A2-TB10.4 | AMLGHAGDM | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein TB10.4 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
antitb_1441 | A2-TB10.4 | MLGHAGDMA | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein TB10.4 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
antitb_1442 | A2-Ag85B | YLLDGLRAQ | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Ag85B | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
antitb_1443 | A2-Ag85B | KLVANNTRL | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Ag85B | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
antitb_1444 | A2-Ag85B | FIYAGSLSA | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Ag85B | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
antitb_1445 | A2-ESAT6 | AMASTEGNV | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein ESAT6 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
antitb_1446 | A2-ESAT | LLDEGKQSL | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein ESAT6 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |