Please click on the ID to see detailed information about each entry.
The total number entries retrieved from this search are| ID | Sequence | Name | Nature of peptide or cargo | Assay | Tissue permeability | Tissue Sample | PUBMED ID |
|---|---|---|---|---|---|---|---|
| 1001 | ACSSSPSKHCG | TD1 | TD1 enhances the transdermal delivery of macromolecules | Franz diffusion cells | Significant increase in permeability of the peptide can be seen by the addition of ATP.The amount of protein that permeated the skin was determined with ELISA | Male SD rats skin cells | 25269793 |
| 1020 | ACSSSPSKHCG | TDN | TD-1 has been testified to enhanced insulin transdermal delivery through hair follicles | Confocal Laser Scanning Microscopy | Significant permeability of the peptide can be seen in confocal images | Male SD rats skin cells | 23391375 |
| 1021 | ACSSKKSKHCG | TD-34 | TD-1 has been testified to enhanced insulin transdermal delivery through hair follicles | Confocal Laser Scanning Microscopy | Significant permeability of the peptide can be seen in confocal images | Male SD rats skin cells | 23391375 |
| 1022 | ACSSSPSKHCG | TD1 | TD1 enhances the transdermal delivery of macromolecules | Franz diffusion cells, immunity fluorescence techniques | Significant permeability of the peptide can be seen. The amount of protein that permeated the skin was determined with immunity fluorescence techniques | Male SD rats skin cells | 23385091 |
| 1096 | ACSSSPSKHCG | TD-1 | Transdermal Delivery enhancer | Fluorescence microscopy, Transmission electron microscopy | Penetrates to the stratum corneum of rat footpad 15 min after topical application. | Footpad skin of rats | 22009459 |
| 1097 | ACSSSPSKHCG | TD-1 | Transdermal Delivery enhancer | Fluorescence microscopy, Transmission electron microscopy | Co-administered FAM-labeled siRNA gathered in the hair follicle 30 min after application | Back skin of rats | 22009459 |
| 1098 | ACSSSPSKHCG | TD-1 | Transdermal Delivery enhancer | Fluorescence microscopy, Transmission electron microscopy | FAM-labeled siRNA and TD-1 topically co-administered penetrated from the stratum corneum to subcutaneous tissue 15 min after application | Footpad skin of rats | 22009459 |
| 1099 | ACSSSPSKHCG | TD-1 | Transdermal Delivery enhancer | Fluorescence microscopy, Transmission electron microscopy | TD1 detected strongly from epithelial tissue to subcutaneous tissue 60 min after application | Footpad skin of rats | 22009459 |
| 1100 | ACSSSPSKHCG | TD-1 | Transdermal Delivery enhancer | Fluorescence microscopy, Transmission electron microscopy | Both FITC-labeled TD-1 and co-administered FAM-labeled siRNA were detected strongly from epithelial tissue to subcutaneous tissue 60 min after application | Footpad skin of rats | 22009459 |
| 1101 | ACSSSPSKHCG | TD-1 | Transdermal Delivery enhancer | RT-PCR | The level of GADPH decreased 37 % | Rat footpad skin | 22009459 |
| 1102 | ACSSSPSKHCG | TD-1 | Transdermal Delivery enhancer | RT-PCR | The level of GADPH decreased 49 % | Rat footpad skin | 22009459 |
| 1103 | CGLHPAFQC | TDA1 | Anti-obesity treatment, Adipose tissue-targeting property and transdermal capacity | Franz cell system | Appearing frequency in the analyzed peptide pool (%) 28/280 (10) | Abdominal skin surface of male wistar rats | 21999821 |
| 1107 | ACSSSPSKHCG | TD-1 | TD1 enhances the transdermal delivery of macromolecules | Electrical stimulation of the saphenous nerve at 4 Hz for 1 min in skin pretreated with vehicle | The maximum amount of PE (Plasma Extravasation) in the control side was 68 ± 3 PIUs compared to 46 ± 2 PIUs in BoNT-A + TD-1 pretreated skin | Dorsal surface of the rat hindpaw skin | 20223589 |
| 1141 | ACSSSPSKHCG | TD-1 | TD1 enhances the transdermal delivery of macromolecules | Confocal Laser Scanning Microscopy, Blood glucose measurement | Significant permeability of insulin could be seen in the confocal images, TD-1 without insulin had no effect on either blood glucose or serum insulin level, indicating that the glucose-lowering effect observed with TD 1 and insulin coadministration was due to the delivered exogenous insulin and not a physiological response elicited by TD-1 | Abdominal skin of rat | 16565728 |
| 1194 | Mpr-YFQNCPrG | Desmopressin | It is a peptide hormone that is used chiefly for treatment of enuresis | Radioimmunoassay | 10 ng/ml serum conc. of desmopressin after ~100 min of coated microneedle array application | Lateral skin areas of the thorax of hairless guinea pigs | 15212882 |
| 1195 | Mpr-YFQNCPrG | Desmopressin | It is a peptide hormone that is used chiefly for treatment of enuresis | Radioimmunoassay | 1 ng/ml serum conc. of desmopressin after ~250 min of coated microneedle array application | Lateral skin areas of the thorax of hairless guinea pigs | 15212882 |
| 1196 | Mpr-YFQNCPrG | Desmopressin | It is a peptide hormone that is used chiefly for treatment of enuresis | Radioimmunoassay | 0.8 ng/ml serum conc. of desmopressin after ~350 min of coated microneedle array application | Lateral skin areas of the thorax of hairless guinea pigs | 15212882 |
| 1199 | pGlu-HWSYGLRPG | LHRH | Peptides containing closely juxtapositioned cationic and lipohilic residues are able to inhibit their own transport across the skin even under the influence of iontophoretic current. | HPLC | LHRH flux= 2.37 ± 0.94 µg h−1 cm−2 at 100% DC | Human cadaver skin | 14757511 |
| 1200 | pGlu-HWSYGLRPG | LHRH | Peptides containing closely juxtapositioned cationic and lipohilic residues are able to inhibit their own transport across the skin even under the influence of iontophoretic current. | HPLC | LHRH flux= 9.87 ± 4.91 µg h−1 cm−2 at 75% pulsed DC | Human cadaver skin | 14757511 |
| 1201 | pGlu-HWSYGLRPG | LHRH | Peptides containing closely juxtapositioned cationic and lipohilic residues are able to inhibit their own transport across the skin even under the influence of iontophoretic current. | HPLC | LHRH flux= 5.57 ± 2.27 µg h−1 cm−2 at 50% pulsed DC | Human cadaver skin | 14757511 |
| 1202 | pGlu-HWSYGLRPG | LHRH | Peptides containing closely juxtapositioned cationic and lipohilic residues are able to inhibit their own transport across the skin even under the influence of iontophoretic current. | HPLC | LHRH flux= 1.21 ± 0.76 µg h−1 cm−2 at 75%+/25%− AC | Human cadaver skin | 14757511 |
| 1203 | pGlu-HWSYGLRPG | LHRH | Peptides containing closely juxtapositioned cationic and lipohilic residues are able to inhibit their own transport across the skin even under the influence of iontophoretic current. | HPLC | LHRH flux= 0.006 ± 0.004 µg h−1 cm−2 at 50%+/50%− AC | Human cadaver skin | 14757511 |
| 1204 | pGlu-HWSY-D-2-Nal-LRPG | Nafarelin | Peptides containing closely juxtapositioned cationic and lipohilic residues are able to inhibit their own transport across the skin even under the influence of iontophoretic current. | HPLC | Nafarelin flux= 1.99 ± 2.04 µg h−1 cm−2 at 100% DC | Human cadaver skin | 14757511 |
| 1205 | pGlu-HWSY-D-2-Nal-LRPG | Nafarelin | Peptides containing closely juxtapositioned cationic and lipohilic residues are able to inhibit their own transport across the skin even under the influence of iontophoretic current. | HPLC | Nafarelin flux= 6.47 ± 0.87 µg h−1 cm−2 at 75% DC | Human cadaver skin | 14757511 |
| 1206 | pGlu-HWSY-D-2-Nal-LRPG | Nafarelin | Peptides containing closely juxtapositioned cationic and lipohilic residues are able to inhibit their own transport across the skin even under the influence of iontophoretic current. | HPLC | Nafarelin flux= 0.96 ± 0.79 µg h−1 cm−2 at 50% pulsed DC | Human cadaver skin | 14757511 |
| 1207 | pGlu-HWSY-D-2-Nal-LRPG | Nafarelin | Peptides containing closely juxtapositioned cationic and lipohilic residues are able to inhibit their own transport across the skin even under the influence of iontophoretic current. | HPLC | Nafarelin flux= 3.33 ± 1.04 µg h−1 cm−2 at 75%+/25%- AC | Human cadaver skin | 14757511 |
| 1208 | pGlu-HWSY-D-2-Nal-LRPG | Nafarelin | Peptides containing closely juxtapositioned cationic and lipohilic residues are able to inhibit their own transport across the skin even under the influence of iontophoretic current. | HPLC | Nafarelin flux= 0.15 ± 0.09 µg h−1 cm−2 at 50%+/50%- AC | Human cadaver skin | 14757511 |
| 1209 | pGlu-HWSYGLRPG | LHRH | Peptides containing closely juxtapositioned cationic and lipohilic residues are able to inhibit their own transport across the skin even under the influence of iontophoretic current. | HPLC | LHRH flux= 12.39 ± 5.32 µg h−1 cm−2 at 75% pulsed DC (500 Hz) | Epidermis of human cadaver skin | 14757511 |
| 1210 | pGlu-HWSYGLRPG | LHRH | Peptides containing closely juxtapositioned cationic and lipohilic residues are able to inhibit their own transport across the skin even under the influence of iontophoretic current. | HPLC | LHRH flux= 5.97 ± 3.20 µg h−1 cm−2 at 50% pulsed DC (500 Hz) | Epidermis of human cadaver skin | 14757511 |
| 1211 | pGlu-HWSYGLRPG | LHRH | Peptides containing closely juxtapositioned cationic and lipohilic residues are able to inhibit their own transport across the skin even under the influence of iontophoretic current. | HPLC | LHRH flux=9.07 ± 4.28 µg h−1 cm−2 at 25% pulsed DC (500 Hz) | Epidermis of human cadaver skin | 14757511 |
| 1212 | pGlu-HWSYGLRPG | LHRH | Peptides containing closely juxtapositioned cationic and lipohilic residues are able to inhibit their own transport across the skin even under the influence of iontophoretic current. | HPLC | LHRH flux= 8.70±3.56 µg h−1 cm−2 at 75% pulsed DC (5 Hz) | Epidermis of human cadaver skin | 14757511 |
| 1213 | pGlu-HWSYGLRPG | LHRH | Peptides containing closely juxtapositioned cationic and lipohilic residues are able to inhibit their own transport across the skin even under the influence of iontophoretic current. | HPLC | LHRH flux= 7.31±1.94 µg h−1 cm−2 at 50% pulsed DC (5 Hz) | Epidermis of human cadaver skin | 14757511 |
| 1214 | pGlu-HWSYGLRPG | LHRH | Peptides containing closely juxtapositioned cationic and lipohilic residues are able to inhibit their own transport across the skin even under the influence of iontophoretic current. | HPLC | LHRH flux= 9.35±1.98 µg h−1 cm−2 at 25% pulsed DC (5 Hz) | Epidermis of human cadaver skin | 14757511 |
| 1218 | I/V-CLe-I/V-K-orn-I/V-fHdN | Bacitracin | Bactericidal antibiotic often used topically. It is a cyclic peptide that contains positively and negatively charged lateral chains at neutral pH and is composed of a mixture of L and D amino acids. | Fluorescein-labeled bacitracin and confocal microscopy, HPLC | Bacitracin Cumulative Amount(µg/cm2)=42.3±3.8 | Human epidermis from abdominal sites of Caucasian females | 12712421 |
| 1219 | I/V-CLe-I/V-K-orn-I/V-fHdN | Bacitracin | Bactericidal antibiotic often used topically. It is a cyclic peptide that contains positively and negatively charged lateral chains at neutral pH and is composed of a mixture of L and D amino acids. | Fluorescein-labeled bacitracin and confocal microscopy, HPLC | Bacitracin Cumulative Amount(µg/cm2)=80.2±4.7 | Human epidermis from abdominal sites of Caucasian females | 12712421 |
| 1220 | I/V-CLe-I/V-K-orn-I/V-fHdN | Bacitracin | Bactericidal antibiotic often used topically. It is a cyclic peptide that contains positively and negatively charged lateral chains at neutral pH and is composed of a mixture of L and D amino acids. | Fluorescein-labeled bacitracin and confocal microscopy, HPLC | Bacitracin Cumulative Amount(µg/cm2)=44.1±4 | Human epidermis from abdominal sites of Caucasian females | 12712421 |
| 1221 | I/V-CLe-I/V-K-orn-I/V-fHdN | Bacitracin | Bactericidal antibiotic often used topically. It is a cyclic peptide that contains positively and negatively charged lateral chains at neutral pH and is composed of a mixture of L and D amino acids. | Fluorescein-labeled bacitracin and confocal microscopy, HPLC | Bacitracin Cumulative Amount(µg/cm2)=82.1±4.4 | Human epidermis from abdominal sites of Caucasian females | 12712421 |
| 1222 | I/V-CLe-I/V-K-orn-I/V-fHdN | Bacitracin | Bactericidal antibiotic often used topically. It is a cyclic peptide that contains positively and negatively charged lateral chains at neutral pH and is composed of a mixture of L and D amino acids. | Fluorescein-labeled bacitracin and confocal microscopy, HPLC | Bacitracin Cumulative Amount(µg/cm2)=52.8±4.4 | Human epidermis from abdominal sites of Caucasian females | 12712421 |
| 1223 | I/V-CLe-I/V-K-orn-I/V-fHdN | Bacitracin | Bactericidal antibiotic often used topically. It is a cyclic peptide that contains positively and negatively charged lateral chains at neutral pH and is composed of a mixture of L and D amino acids. | Fluorescein-labeled bacitracin and confocal microscopy, HPLC | Bacitracin Cumulative Amount(µg/cm2)=95±2.9 | Human epidermis from abdominal sites of Caucasian females | 12712421 |
| 1224 | (Chain A: GIVEQCCTSICSLYQLENYCN) (Chain B: FVNQHLCGSHLVEALYLVCGERGFFYTPKT) | Insulin in poloxamer gel 407 | It is used in the treatment diabetes mellitus and has immense therapeutic and commercial importance | Franz diffusion cells, Radioimuunoassay | Skin permeation parameters of insulin from poloxamer 407 gel using menthone enhancer, Lag time (h)=1.20 (0.02) , Flux (µg/cm2 /h)=5.57 (0.13), Cumulative amount permeated (µg)=210.78 (2.64), Skin affinity=10.57 (0.38), (P<0.05), all values are n=3 | Female Sprague–Dawley rat skin | 12695068 |
| 1225 | (Chain A: GIVEQCCTSICSLYQLENYCN) (Chain B: FVNQHLCGSHLVEALYLVCGERGFFYTPKT) | Insulin in poloxamer gel 408 | It is used in the treatment diabetes mellitus and has immense therapeutic and commercial importance | Franz diffusion cells, Radioimuunoassay | Skin permeation parameters of insulin from poloxamer 407 gel using linoleic acid enhancer, Lag time (h)=0.65 (0.49) , Flux (µg/cm2 /h)=8.08 (0.20), Cumulative amount permeated (µg)=244.38 (30.21), Skin affinity=5.28 (2.37), (P<0.05), all values are n=3 | Female Sprague–Dawley rat skin | 12695068 |
| 1245 | pGlu-HP | Thyrotropin-releasing hormone (TRH) | It is a tripeptide that used in the treatment of brain and spinal cord injury and certain CNS disorders, including Alzheimer’s disease and motor neuron disease (MND) | Radioimmunoassay and Liquid Scintillation Technique | Permeability coefficient (Kp)= 18.4*105 cm/h, Cumulative amount= 24.9± 1.7 µg/cm2, Enhancement factor (EF) =3.4 | Human epidermal membrane | 10205635 |
| 1246 | pGlu-HP | Thyrotropin-releasing hormone (TRH) | It is a tripeptide that used in the treatment of brain and spinal cord injury and certain CNS disorders, including Alzheimer’s disease and motor neuron disease (MND) | Radioimmunoassay and Liquid Scintillation Technique | Permeability coefficient (Kp)= 16.6*105 cm/h, Cumulative amount= 18.5± 2.1 µg/cm2, Enhancement factor (EF) =3.1 | Human epidermal membrane | 10205635 |
| 1247 | pGlu-HP | Thyrotropin-releasing hormone (TRH) | It is a tripeptide that used in the treatment of brain and spinal cord injury and certain CNS disorders, including Alzheimer’s disease and motor neuron disease (MND) | Radioimmunoassay and Liquid Scintillation Technique | Permeability coefficient (Kp)= 5.4*105 cm/h, Cumulative amount= 7.8± 1.7 µg/cm2, Enhancement factor (EF) =0 | Human epidermal membrane | 10205635 |
| 1248 | pGlu-3-methyl-HP | M-TRH | Analogue of TRH i.e. M-TRH is a potent analogue and stimulates the release of TSH from the pituitary seven to eight times that of the parental tripeptide. | Liquid Scintillation Technique | Permeability coefficient (Kp)= 32.0*105 cm/h, Cumulative amount= 41.5±4.9 µg/cm2, Enhancement factor (EF) =4.7 | Human epidermal membrane | 10205635 |
| 1249 | pGlu-3-methyl-HP | M-TRH | Analogue of TRH i.e. M-TRH is a potent analogue and stimulates the release of TSH from the pituitary seven to eight times that of the parental tripeptide. | Liquid Scintillation Technique | Permeability coefficient (Kp)=20.2*105 cm/h, Cumulative amount= 20.4± 3.6µg/cm2, Enhancement factor (EF) =3.0 | Human epidermal membrane | 10205635 |
| 1250 | pGlu-3-methyl-HP | M-TRH | Analogue of TRH i.e. M-TRH is a potent analogue and stimulates the release of TSH from the pituitary seven to eight times that of the parental tripeptide. | Liquid Scintillation Technique | Permeability coefficient (Kp)= 6.8*105 cm/h, Cumulative amount= 8.6± 1.0 µg/cm2, Enhancement factor (EF) =0 | Human epidermal membrane | 10205635 |
| 1265 | SNLST-Asu-VLGKLSQELH KLQTYPRTDVGAGTP | Elcatonin | It stimulates osteoblastic bone formation in addition to inhibiting osteoclastic bone resorption | Calcium C-Test Wako kit, Ames method, Alkaline Phospha K-Test and ANOVA | Parameters studied: Ca(mg/dl)- 8.83±0.20/8.94±0.17(control), P(mg/dl)- 5.32±0.35/5.58±0.55(control) and Alkaline phosphatase- 23.69±1.16/18.83±0.75(control) | Abdominal skin of female wistar rats | 8268857 |
| 1266 | SNLST-Asu-VLGKLSQELH KLQTYPRTDVGAGTP | Elcatonin | It stimulates osteoblastic bone formation in addition to inhibiting osteoclastic bone resorption | Calcium C-Test Wako kit, Ames method, Alkaline Phospha K-Test and ANOVA | Parameters studied: Ca(mg/dl)- 8.80±0.27/8.94±0.17(control), P(mg/dl)- 5.22±0.36/5.58±0.55(control) and Alkaline phosphatase- 22.21±4.01/18.83±0.75(control) | Abdominal skin of female wistar rats | 8268857 |
| 1335 | SNLST-Asu-VLGKLSQEL HKLQTYPRTDVGAGTP | Elcatonin | It stimulates osteoblastic bone formation in addition to inhibiting osteoclastic bone resorption | o-cresolphthalein complexone method using Calcium C-Test Wako and 0.01 ml plasma, pharmacokinetic and statistical analysis | Area under the curve(mg.h/dl)=30.99±11.75 , Area under the first moment curve(mg.h2/dl)=371.41±159.80 , The mean residence time(h)=12.06±1.99 , Apparent bioavailability(%)=2.68. | Stratum corneum of the abdominal area of male Wistar rats(0.5g ointment/4 cm2/rat) | 2054872 |