Browse result page of PRRDB 2.0

PRRID	Name of Ligand	Source of ligand	Sequence of Ligand	Length of Ligand	Type of Ligand	Occurence	Role of Ligand	Name of Receptor	Type of Reeptor	Source of the Receptor	Localization	Domain	Sequence of Receptor	Swiss prot ID	Length of receptor	Function of Receptor	Assay used	PMID	Year of publication	Pubchem assay
RID_0001	6-O-stearoyl-MDP (L18- MDP) Click for more detail	MDP (others)	CCCCCCCCCCCCCCCCCC(=O)NCCCCC(C(=O)O)NC(=O)CCC(C(=O)N)NC(=O)C(C)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptide	Synthetic	It leads to the induction of interferon in the lung.	Nod-like receptor 2 (NOD2)	NOD-like receptor (NLR)		Lungs	NA	Q8K3Z0.fasta	Q8K3Z0	1020	It augments host-resistance to viral infection.	Interferon assay	2417426	1985	Pubchem Assay
RID_0001	6-O-stearoyl-MDP (L18- MDP) Click for more detail	MDP (others)	CCCCCCCCCCCCCCCCCC(=O)NCCCCC(C(=O)O)NC(=O)CCC(C(=O)N)NC(=O)C(C)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptide	Synthetic	It leads to the induction of interferon in the lung.	Nod-like receptor 2 (NOD2)	NOD-like receptor (NLR)		Lungs	NA	Q8K3Z0.fasta	Q8K3Z0	1020	It augments host-resistance to viral infection.	Interferon assay	2417426	1985	Pubchem Assay
PRRID_0002	N-acetylmuramyl-L-alanyl-D-isoglutamine (MDP) Click for more detail	NA	CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptide	Synthetic	It leads to the induction of interferon in the lung.	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Sendai virus infected mice	Lungs	NA	Q8K3Z0.fasta	Q8K3Z0	1020	It augments host-resistance to viral infection.	Interferon assay	2417426	1985	Pubchem Assay
PRRID_0002	N-acetylmuramyl-L-alanyl-D-isoglutamine (MDP) Click for more detail	NA	CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptide	Synthetic	It leads to the induction of interferon in the lung.	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Sendai virus infected mice	Lungs	NA	Q8K3Z0.fasta	Q8K3Z0	1020	It augments host-resistance to viral infection.	Interferon assay	2417426	1985	Pubchem Assay
PRRID_0003	N(alpha)-acetylmuramyl-L-alanyl-D-isoglutaminyl-N(epsilon)-stearoyl'L'lysine (MDP-L ys-L18) Click for more detail	MDP (others)	CCCCCCCCCCCCCCCCCC(=O)NCCCCC(C(=O)O)NC(=O)CCC(C(=O)N)NC(=O)C(C)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptide	Synthetic	It leads to the induction of interferon in the lung.	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Sendai virus infected mice	Lungs	NA	Q8K3Z0.fasta	Q8K3Z0	1020	It augments host-resistance to viral infection.	Interferon assay	2417426	1985	Pubchem Assay
PRRID_0003	N(alpha)-acetylmuramyl-L-alanyl-D-isoglutaminyl-N(epsilon)-stearoyl'L'lysine (MDP-L ys-L18) Click for more detail	MDP (others)	CCCCCCCCCCCCCCCCCC(=O)NCCCCC(C(=O)O)NC(=O)CCC(C(=O)N)NC(=O)C(C)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptide	Synthetic	It leads to the induction of interferon in the lung.	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Sendai virus infected mice	Lungs	NA	Q8K3Z0.fasta	Q8K3Z0	1020	It augments host-resistance to viral infection.	Interferon assay	2417426	1985	Pubchem Assay
PRRID_0042	poly D-glutamic acid Click for more detail	synthetic polypeptyide (others)	C(CC(=O)O)C(C(=O)O)N	NA	Peptide	Natural	Immunostimulant	Scavenger receptor C-1 (SR-C1)	Scavenger receptor (SR)	Drosophila melanogaster	NA	two complement control protein (CCP) domains and somatomedin B, MAM, and mucin-like domains	NA	NA	NA	NA	NA	7732030	1995	NA
PRRID_0042	poly D-glutamic acid Click for more detail	synthetic polypeptyide (others)	C(CC(=O)O)C(C(=O)O)N	NA	Peptide	Natural	Immunostimulant	Scavenger receptor C-1 (SR-C1)	Scavenger receptor (SR)	Drosophila melanogaster	NA	two complement control protein (CCP) domains and somatomedin B, MAM, and mucin-like domains	NA	NA	NA	NA	NA	7732030	1995	NA
PRRID_0046	amyloid beta peptide Click for more detail	Endogenous (others)	MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAMSQSLLKTTQEPLARDPVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN	770	Peptide	Natural	Immunostimulant	Scavenger receptor A I (SR-A I)	Scavenger receptor (SR)	NA	NA	NA	NA	NA	NA	NA	ELISA	8816718	1996	NA
PRRID_0046	amyloid beta peptide Click for more detail	Endogenous (others)	MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAMSQSLLKTTQEPLARDPVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN	770	Peptide	Natural	Immunostimulant	Scavenger receptor A I (SR-A I)	Scavenger receptor (SR)	NA	NA	NA	NA	NA	NA	NA	ELISA	8816718	1996	NA
PRRID_0047	amyloid beta peptide Click for more detail	Endogenous (others)	MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAMSQSLLKTTQEPLARDPVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN	770	Peptide	Natural	Immunostimulant	Scavenger receptor A I (SR-A I)	Scavenger receptor (SR)	NA	NA	NA	NA	NA	NA	NA	ELISA	8816718	1996	NA
PRRID_0047	amyloid beta peptide Click for more detail	Endogenous (others)	MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAMSQSLLKTTQEPLARDPVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN	770	Peptide	Natural	Immunostimulant	Scavenger receptor A I (SR-A I)	Scavenger receptor (SR)	NA	NA	NA	NA	NA	NA	NA	ELISA	8816718	1996	NA
PRRID_0115	beta-defensin Click for more detail	Endogenous (others)	MKTHYFLLVMICFLFSQMEPGVGILTSLGRRTDQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS	69	Peptide	Natural	Immunostimulant	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	NA	NA	NA	NA	NA	NA	NA	NA	12411706	2002	NA
PRRID_0115	beta-defensin Click for more detail	Endogenous (others)	MKTHYFLLVMICFLFSQMEPGVGILTSLGRRTDQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS	69	Peptide	Natural	Immunostimulant	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	NA	NA	NA	NA	NA	NA	NA	NA	12411706	2002	NA
PRRID_0163	C12-iE-DAP Click for more detail	Chemical derivative of iE-DAP(others)	N[C@@H](CCC[C@@H](NC(=O)CC[C@@H](N)C(O)=O)C(O)=O)C(O)=O	NA	Peptide	Synthetic	elicit innate immune response	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Mice (Murine)	Macrophages	NA	Q8BHB0.fasta	Q8BHB0	953	mediates selective recognition of bacteria through detection of iE-DAP-containing peptidoglycan.	ELISA	12796777	2003	Pubchem Assay
PRRID_0163	C12-iE-DAP Click for more detail	Chemical derivative of iE-DAP(others)	N[C@@H](CCC[C@@H](NC(=O)CC[C@@H](N)C(O)=O)C(O)=O)C(O)=O	NA	Peptide	Synthetic	elicit innate immune response	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Mice (Murine)	Macrophages	NA	Q8BHB0.fasta	Q8BHB0	953	mediates selective recognition of bacteria through detection of iE-DAP-containing peptidoglycan.	ELISA	12796777	2003	Pubchem Assay
PRRID_0173	iE-DAP (gamma-D-glutamyl-meso diaminopimelic acid) Click for more detail	Bacteria	N[C@@H](CCC[C@@H](NC(=O)CC[C@@H](N)C(O)=O)C(O)=O)C(O)=O	NA	Peptide	Natural	elicit innate immune response	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Mice (Murine)	Macrophages	NA	Q8BHB0.fasta	Q8BHB0	953	mediates selective recognition of bacteria through detection of iE-DAP-containing peptidoglycan.	ELISA	12796777	2003	Pubchem Assay
PRRID_0173	iE-DAP (gamma-D-glutamyl-meso diaminopimelic acid) Click for more detail	Bacteria	N[C@@H](CCC[C@@H](NC(=O)CC[C@@H](N)C(O)=O)C(O)=O)C(O)=O	NA	Peptide	Natural	elicit innate immune response	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Mice (Murine)	Macrophages	NA	Q8BHB0.fasta	Q8BHB0	953	mediates selective recognition of bacteria through detection of iE-DAP-containing peptidoglycan.	ELISA	12796777	2003	Pubchem Assay
PRRID_0178	M-Tri-DAP (MurNAc-L-Ala-D-g-Glu-mDAP) Click for more detail	Gram-negative bacteria	NA	NA	Peptide	Natural	activation of the NF-Œ∫B pro-inflammatory cascade	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Human	Macrophages	NA	Q9Y239.fasta	Q9Y239	953	production of pro-inflammatory cytokines	NA	12527755	2003	Pubchem Assay
PRRID_0178	M-Tri-DAP (MurNAc-L-Ala-D-g-Glu-mDAP) Click for more detail	Gram-negative bacteria	NA	NA	Peptide	Natural	activation of the NF-Œ∫B pro-inflammatory cascade	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Human	Macrophages	NA	Q9Y239.fasta	Q9Y239	953	production of pro-inflammatory cytokines	NA	12527755	2003	Pubchem Assay
PRRID_0180	muramyl tripeptide Click for more detail	muramyl dipeptide derivative (others)	CCCCCCCCCCCCCCCC(=O)OCC(COP(=O)(O)OCCNC(=O)C(C)NC(=O)CCC(C(=O)N)NC(=O)C(C)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C)OC(=O)CCCCCCCCCCCCCCC	NA	Peptide	Synthetic	activation of the NF-Œ∫B pro-inflammatory cascade	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Human	Macrophages	NA	Q9Y239.fasta	Q9Y239	953	production of pro-inflammatory cytokines	NA	12527755	2003	Pubchem Assay
PRRID_0180	muramyl tripeptide Click for more detail	muramyl dipeptide derivative (others)	CCCCCCCCCCCCCCCC(=O)OCC(COP(=O)(O)OCCNC(=O)C(C)NC(=O)CCC(C(=O)N)NC(=O)C(C)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C)OC(=O)CCCCCCCCCCCCCCC	NA	Peptide	Synthetic	activation of the NF-Œ∫B pro-inflammatory cascade	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Human	Macrophages	NA	Q9Y239.fasta	Q9Y239	953	production of pro-inflammatory cytokines	NA	12527755	2003	Pubchem Assay
PRRID_0188	Tri-DAP (L-Ala-D-g-Glu-mDAP) Click for more detail	Bacteria	CC(C(=O)NC(CCC(=O)NC(CCCC(C(=O)O)N)C(=O)O)C(=O)O)N	NA	Peptide	Natural	activation of the NF-Œ∫B pro-inflammatory cascade	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Human	Macrophages	NA	Q9Y239.fasta	Q9Y239	953	Phagocytosis of pathogens, Antigen presentation, Intracellular signalling, Resolution of inflammation	NA	12527755	2003	Pubchem Assay
PRRID_0188	Tri-DAP (L-Ala-D-g-Glu-mDAP) Click for more detail	Bacteria	CC(C(=O)NC(CCC(=O)NC(CCCC(C(=O)O)N)C(=O)O)C(=O)O)N	NA	Peptide	Natural	activation of the NF-Œ∫B pro-inflammatory cascade	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Human	Macrophages	NA	Q9Y239.fasta	Q9Y239	953	Phagocytosis of pathogens, Antigen presentation, Intracellular signalling, Resolution of inflammation	NA	12527755	2003	Pubchem Assay
PRRID_0220	FK156 Click for more detail	NA	CC(C(=O)NC(CCC(=O)NC(CCCC(C(=O)O)N)C(=O)NCC(=O)O)C(=O)O)NC(=O)C(C)O	NA	Peptide	Synthetic	It induces the secretion of the IL-8	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Human	Monocytes	NA	Q9Y239.fasta	Q9Y239	953	It leads to the maturation and activation of the host cells.	ELISA	15617523	2005	Pubchem Assay
PRRID_0220	FK156 Click for more detail	NA	CC(C(=O)NC(CCC(=O)NC(CCCC(C(=O)O)N)C(=O)NCC(=O)O)C(=O)O)NC(=O)C(C)O	NA	Peptide	Synthetic	It induces the secretion of the IL-8	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Human	Monocytes	NA	Q9Y239.fasta	Q9Y239	953	It leads to the maturation and activation of the host cells.	ELISA	15617523	2005	Pubchem Assay
PRRID_0221	FK565 Click for more detail	NA	CC(C)(C)OC(=O)CCC(C(=O)O)NC(=O)OC(C)(C)C	NA	Peptide	Synthetic	It induces the secretion of the IL-8	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Human	Monocytes	NA	Q9Y239.fasta	Q9Y239	953	It leads to the maturation and activation of the host cells.	ELISA	15617523	2005	Pubchem Assay
PRRID_0221	FK565 Click for more detail	NA	CC(C)(C)OC(=O)CCC(C(=O)O)NC(=O)OC(C)(C)C	NA	Peptide	Synthetic	It induces the secretion of the IL-8	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Human	Monocytes	NA	Q9Y239.fasta	Q9Y239	953	It leads to the maturation and activation of the host cells.	ELISA	15617523	2005	Pubchem Assay
PRRID_0225	muramyl tetrapeptide Click for more detail	muramyl dipeptide derivative (others)	NA	NA	Peptide	Synthetic	Immunostimulant	Nucleotide-binding oligomerization domain protein 1	NOD-like receptor (NLR)	Mice (Murine)	NA	NA	Q8BHB0.fasta	Q8BHB0	953	NA	ELISA	16211083	2005	Pubchem Assay
PRRID_0225	muramyl tetrapeptide Click for more detail	muramyl dipeptide derivative (others)	NA	NA	Peptide	Synthetic	Immunostimulant	Nucleotide-binding oligomerization domain protein 1	NOD-like receptor (NLR)	Mice (Murine)	NA	NA	Q8BHB0.fasta	Q8BHB0	953	NA	ELISA	16211083	2005	Pubchem Assay
PRRID_0414	AtPep1 Click for more detail	Arabidopsis thaliana(plant)	ATKVKAKQRGKEKVSSGRPGQHN	23	Peptide	Natural	It triggers a receptor-dependent transient depolarization through activation of plasma membrane anion channels.	PEPR1	Toll-like receptor (TLR)	Arabidopsis	Plasma membrane	LRR	NA	NA	NA	It caused seedling growth inhibition of arabidopsis thaliana	Growth inhibition assay	20200150	2010	NA
PRRID_0414	AtPep1 Click for more detail	Arabidopsis thaliana(plant)	ATKVKAKQRGKEKVSSGRPGQHN	23	Peptide	Natural	It triggers a receptor-dependent transient depolarization through activation of plasma membrane anion channels.	PEPR1	Toll-like receptor (TLR)	Arabidopsis	Plasma membrane	LRR	NA	NA	NA	It caused seedling growth inhibition of arabidopsis thaliana	Growth inhibition assay	20200150	2010	NA
PRRID_0415	AtPep2 Click for more detail	NA	DNKAKSKKRDKEKPSSGRPGQTNSVPNAAIQVYKED	36	Peptide	Synthetic	It increase cytosolic calcium and activate chloride channels followed by membrane depolarization in a strictly receptor-dependent manner.	PEPR1	Toll-like receptor (TLR)	Arabidopsis	Plasma membrane	LRR	NA	NA	NA	It caused seedling growth inhibition of arabidopsis thaliana	Growth inhibition assay	20200150	2010	NA
PRRID_0415	AtPep2 Click for more detail	NA	DNKAKSKKRDKEKPSSGRPGQTNSVPNAAIQVYKED	36	Peptide	Synthetic	It increase cytosolic calcium and activate chloride channels followed by membrane depolarization in a strictly receptor-dependent manner.	PEPR1	Toll-like receptor (TLR)	Arabidopsis	Plasma membrane	LRR	NA	NA	NA	It caused seedling growth inhibition of arabidopsis thaliana	Growth inhibition assay	20200150	2010	NA
PRRID_0416	AtPep3 Click for more detail	NA	EIKARGKNKTKPTPSSGKGGKHN	23	Peptide	Synthetic	It increase cytosolic calcium and activate chloride channels followed by membrane depolarization in a strictly receptor-dependent manner.	PEPR1	Toll-like receptor (TLR)	Arabidopsis	Plasma membrane	LRR	NA	NA	NA	It caused seedling growth inhibition of arabidopsis thaliana	Growth inhibition assay	20200150	2010	NA
PRRID_0416	AtPep3 Click for more detail	NA	EIKARGKNKTKPTPSSGKGGKHN	23	Peptide	Synthetic	It increase cytosolic calcium and activate chloride channels followed by membrane depolarization in a strictly receptor-dependent manner.	PEPR1	Toll-like receptor (TLR)	Arabidopsis	Plasma membrane	LRR	NA	NA	NA	It caused seedling growth inhibition of arabidopsis thaliana	Growth inhibition assay	20200150	2010	NA
PRRID_0417	AtPep4 Click for more detail	NA	NA	NA	Peptide	Synthetic	It increase cytosolic calcium and activate chloride channels followed by membrane depolarization in a strictly receptor-dependent manner.	PEPR1	Toll-like receptor (TLR)	Arabidopsis	Plasma membrane	LRR	NA	NA	NA	It caused seedling growth inhibition of arabidopsis thaliana	Growth inhibition assay	20200150	2010	NA
PRRID_0417	AtPep4 Click for more detail	NA	NA	NA	Peptide	Synthetic	It increase cytosolic calcium and activate chloride channels followed by membrane depolarization in a strictly receptor-dependent manner.	PEPR1	Toll-like receptor (TLR)	Arabidopsis	Plasma membrane	LRR	NA	NA	NA	It caused seedling growth inhibition of arabidopsis thaliana	Growth inhibition assay	20200150	2010	NA
PRRID_0418	AtPep5 Click for more detail	NA	NA	NA	Peptide	Synthetic	It increase cytosolic calcium and activate chloride channels followed by membrane depolarization in a strictly receptor-dependent manner.	PEPR1	Toll-like receptor (TLR)	Arabidopsis	Plasma membrane	LRR	NA	NA	NA	It caused seedling growth inhibition of arabidopsis thaliana	Growth inhibition assay	20200150	2010	NA
PRRID_0418	AtPep5 Click for more detail	NA	NA	NA	Peptide	Synthetic	It increase cytosolic calcium and activate chloride channels followed by membrane depolarization in a strictly receptor-dependent manner.	PEPR1	Toll-like receptor (TLR)	Arabidopsis	Plasma membrane	LRR	NA	NA	NA	It caused seedling growth inhibition of arabidopsis thaliana	Growth inhibition assay	20200150	2010	NA
PRRID_0419	AtPep6 Click for more detail	NA	NA	NA	Peptide	Synthetic	It increase cytosolic calcium and activate chloride channels followed by membrane depolarization in a strictly receptor-dependent manner.	PEPR1	Toll-like receptor (TLR)	Arabidopsis	Plasma membrane	LRR	NA	NA	NA	It caused seedling growth inhibition of arabidopsis thaliana	Growth inhibition assay	20200150	2010	NA
PRRID_0419	AtPep6 Click for more detail	NA	NA	NA	Peptide	Synthetic	It increase cytosolic calcium and activate chloride channels followed by membrane depolarization in a strictly receptor-dependent manner.	PEPR1	Toll-like receptor (TLR)	Arabidopsis	Plasma membrane	LRR	NA	NA	NA	It caused seedling growth inhibition of arabidopsis thaliana	Growth inhibition assay	20200150	2010	NA
PRRID_0494	elf18 Click for more detail	NA	NA	NA	Peptide	Natural	It bind to the FLS2 and incites the downstream cascade.	EFR	Toll-like receptor (TLR)	Arabidopsis	Plasma membrane	LRR	C0LGT6.fasta	C0LGT6	1031	It caused seedling growth inhibition of arabidopsis thaliana	Growth inhibition assay	20200150	2010	Pubchem Assay
PRRID_0494	elf18 Click for more detail	NA	NA	NA	Peptide	Natural	It bind to the FLS2 and incites the downstream cascade.	EFR	Toll-like receptor (TLR)	Arabidopsis	Plasma membrane	LRR	C0LGT6.fasta	C0LGT6	1031	It caused seedling growth inhibition of arabidopsis thaliana	Growth inhibition assay	20200150	2010	Pubchem Assay
PRRID_0523	flg22 Click for more detail	Bacteria	QRLSTGSRINSAKDDAAGLQIA	22	Peptide	Natural	It bind to the FLS2 and incites the downstream cascade.	FLS2	Pattern recognition receptor (PRR)	Arabidopsis	Plasma membrane	LRR	Q9FL28.fasta	Q9FL28	1173	It caused seedling growth inhibition of arabidopsis thaliana	Growth inhibition assay	20200150	2010	Pubchem Assay
PRRID_0523	flg22 Click for more detail	Bacteria	QRLSTGSRINSAKDDAAGLQIA	22	Peptide	Natural	It bind to the FLS2 and incites the downstream cascade.	FLS2	Pattern recognition receptor (PRR)	Arabidopsis	Plasma membrane	LRR	Q9FL28.fasta	Q9FL28	1173	It caused seedling growth inhibition of arabidopsis thaliana	Growth inhibition assay	20200150	2010	Pubchem Assay
PRRID_0524	fMLF Click for more detail	NA	NA	NA	Peptide	Synthetic	It activates the PMN in circukation and promote the Ca2+ flux and phosphorylation of MAP kinases	Formyl peptide receptor 1	Pattern recognition receptor (PRR)	Human	Neutrophils	NA	P21462.fasta	P21462	350	It incites non-specific organ attack and suppresses chemotactic responsess to infective stimuli.	Chemotaxis assay	20203610	2010	Pubchem Assay
PRRID_0524	fMLF Click for more detail	NA	NA	NA	Peptide	Synthetic	It activates the PMN in circukation and promote the Ca2+ flux and phosphorylation of MAP kinases	Formyl peptide receptor 1	Pattern recognition receptor (PRR)	Human	Neutrophils	NA	P21462.fasta	P21462	350	It incites non-specific organ attack and suppresses chemotactic responsess to infective stimuli.	Chemotaxis assay	20203610	2010	Pubchem Assay
PRRID_0679	mesodiaminopimelic acid Click for more detail	Bacteria	C(CC(C(=O)O)N)CC(C(=O)O)N	NA	Peptide	Natural	upon ligand sensing, oligomerize and recruit RIP2 via CARD-CARD interactions	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	It culminates in the activation of the NF-kB transcription factor, which drives proinflammatory gene regulation	NA	20303873	2010	NA
PRRID_0679	mesodiaminopimelic acid Click for more detail	Bacteria	C(CC(C(=O)O)N)CC(C(=O)O)N	NA	Peptide	Natural	upon ligand sensing, oligomerize and recruit RIP2 via CARD-CARD interactions	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	It culminates in the activation of the NF-kB transcription factor, which drives proinflammatory gene regulation	NA	20303873	2010	NA
PRRID_0692	muramyl dipeptide (MDP) Click for more detail	Streptococcus pneumoniae, Mycobacterium tuberculosis, and Listeria monocytogenes (Bacteria)	CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptide	Natural	Activates NF-KB which results in the processing and release of the proinfl ammatory cytokines IL-1Œ≤, which results into pathogen clearance and sepsis resistance	cluster of differentiation 14 (CD14)	Pattern recognition receptor (PRR)	Human	NA	NA	Q9HC29.fasta	Q9HC29	1040	It results into pathogen clearance and sepsis resistance	NA	20740341	2010	Pubchem Assay
PRRID_0692	muramyl dipeptide (MDP) Click for more detail	Streptococcus pneumoniae, Mycobacterium tuberculosis, and Listeria monocytogenes (Bacteria)	CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptide	Natural	Activates NF-KB which results in the processing and release of the proinfl ammatory cytokines IL-1Œ≤, which results into pathogen clearance and sepsis resistance	cluster of differentiation 14 (CD14)	Pattern recognition receptor (PRR)	Human	NA	NA	Q9HC29.fasta	Q9HC29	1040	It results into pathogen clearance and sepsis resistance	NA	20740341	2010	Pubchem Assay
PRRID_0693	muramyl dipeptide (MDP) Click for more detail	Bacteria	CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptide	Natural	upon ligand sensing, oligomerize and recruit RIP2 via CARD-CARD interactions	Nod-like receptor C4 (NLRC4)	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	It culminates in the activation of the NF-kB transcription factor, which drives proinflammatory gene regulation	NA	20303873	2010	NA
PRRID_0693	muramyl dipeptide (MDP) Click for more detail	Bacteria	CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptide	Natural	upon ligand sensing, oligomerize and recruit RIP2 via CARD-CARD interactions	Nod-like receptor C4 (NLRC4)	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	It culminates in the activation of the NF-kB transcription factor, which drives proinflammatory gene regulation	NA	20303873	2010	NA
PRRID_0694	muramyl dipeptide (MDP) + LPS + Poly(I:C) Click for more detail	Bacteria	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Peptide	Natural	It help in NF	Nod-like receptor C4 (NLRC4)	NOD-like receptor (NLR)	C57BL/6 Mice	liver and Hepatocytes	NA	Q3UP24.fasta	Q3UP24	1024	It plays an important regulatory role in many inflammatory processes involving the liver.	Immunoblotting and EMSA	20615568	2010	Pubchem Assay
PRRID_0694	muramyl dipeptide (MDP) + LPS + Poly(I:C) Click for more detail	Bacteria	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Peptide	Natural	It help in NF	Nod-like receptor C4 (NLRC4)	NOD-like receptor (NLR)	C57BL/6 Mice	liver and Hepatocytes	NA	Q3UP24.fasta	Q3UP24	1024	It plays an important regulatory role in many inflammatory processes involving the liver.	Immunoblotting and EMSA	20615568	2010	Pubchem Assay
PRRID_0871	beta-defensin Click for more detail	Endogenous (others)	MKTHYFLLVMICFLFSQMEPGVGILTSLGRRTDQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS	69	Peptide	Natural	Defensins are cationic, microbicidal peptides active against many Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Myeloid cells, microglia, astrocytes, neurons	NA	O00206.fasta	O00206	839	plays a fundamental role in¬†pathogen¬†recognition and activation of¬†innate immunity	NA	21982558	2011	Pubchem Assay
PRRID_0871	beta-defensin Click for more detail	Endogenous (others)	MKTHYFLLVMICFLFSQMEPGVGILTSLGRRTDQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS	69	Peptide	Natural	Defensins are cationic, microbicidal peptides active against many Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Myeloid cells, microglia, astrocytes, neurons	NA	O00206.fasta	O00206	839	plays a fundamental role in¬†pathogen¬†recognition and activation of¬†innate immunity	NA	21982558	2011	Pubchem Assay
PRRID_0935	MDP (muramyldipeptide) Click for more detail	Gram-negative and Gram-positive bacteria	CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptide	Natural	leads to cytokine activation, especially¬†IL-1Œ±¬†and¬†IL-1Œ≤.	Nucleotide-binding oligomerization domain, Leucine rich Repeat and Pyrin domain containing3 (Nalp3)	NOD-like receptor (NLR)	Human	Eosinophils	NA	Q96P20.fasta	Q96P20	1036	recognizes fragments of the bacterial cell wall	real-time reverse transcription-PCR, FACS, ELISA	21978001	2011	Pubchem Assay
PRRID_0935	MDP (muramyldipeptide) Click for more detail	Gram-negative and Gram-positive bacteria	CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptide	Natural	leads to cytokine activation, especially¬†IL-1Œ±¬†and¬†IL-1Œ≤.	Nucleotide-binding oligomerization domain, Leucine rich Repeat and Pyrin domain containing3 (Nalp3)	NOD-like receptor (NLR)	Human	Eosinophils	NA	Q96P20.fasta	Q96P20	1036	recognizes fragments of the bacterial cell wall	real-time reverse transcription-PCR, FACS, ELISA	21978001	2011	Pubchem Assay
PRRID_0987	Defensins Click for more detail	NA	MKTHYFLLVMICFLFSQMEPGVGILTSLGRRTDQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS	69	Peptide	Natural	Immunostimulant	Unknown	Pattern recognition receptor (PRR)	NA	NA	NA	NA	NA	NA	Antagonists and antibodies	NA	22982943	2012	NA
PRRID_0987	Defensins Click for more detail	NA	MKTHYFLLVMICFLFSQMEPGVGILTSLGRRTDQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS	69	Peptide	Natural	Immunostimulant	Unknown	Pattern recognition receptor (PRR)	NA	NA	NA	NA	NA	NA	Antagonists and antibodies	NA	22982943	2012	NA
PRRID_1110	muramyl dipeptide (MDP) Click for more detail	Gram-positive and negative bacteria	CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptide	Natural	a component of bacterial peptidoglycan, and induces NF-jB activation, leading to enhanced Th1 responses	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Mice	graft-versus-host disease (GVHD)	NA	Q8K3Z0.fasta	Q8K3Z0	1020	NOD2 functions as a primary sensor of microbial products inducing inflammatory T-cell responses and also negatively regulates TLR-mediated responses	NA	23985302	2013	Pubchem_assay
PRRID_1110	muramyl dipeptide (MDP) Click for more detail	Gram-positive and negative bacteria	CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptide	Natural	a component of bacterial peptidoglycan, and induces NF-jB activation, leading to enhanced Th1 responses	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Mice	graft-versus-host disease (GVHD)	NA	Q8K3Z0.fasta	Q8K3Z0	1020	NOD2 functions as a primary sensor of microbial products inducing inflammatory T-cell responses and also negatively regulates TLR-mediated responses	NA	23985302	2013	Pubchem_assay
PRRID_1130	muramyl dipeptide (MDP) Click for more detail	Gram-positive and negative bacteria	CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptide	Natural	a component of bacterial peptidoglycan, and induces NF-jB activation, leading to enhanced Th1 responses	Nod-like receptor protein 3 (P2X7R) (NLRP3 (P2X7R)	NOD-like receptor (NLR)	Human	graft-versus-host disease (GVHD)	NA	Q96P20.fasta	Q96P20	1036	NOD2 functions as a primary sensor of microbial products inducing inflammatory T-cell responses and also negatively regulates TLR-mediated responses	NA	23985302	2013	Pubchem_assay
PRRID_1130	muramyl dipeptide (MDP) Click for more detail	Gram-positive and negative bacteria	CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptide	Natural	a component of bacterial peptidoglycan, and induces NF-jB activation, leading to enhanced Th1 responses	Nod-like receptor protein 3 (P2X7R) (NLRP3 (P2X7R)	NOD-like receptor (NLR)	Human	graft-versus-host disease (GVHD)	NA	Q96P20.fasta	Q96P20	1036	NOD2 functions as a primary sensor of microbial products inducing inflammatory T-cell responses and also negatively regulates TLR-mediated responses	NA	23985302	2013	Pubchem_assay
PRRID_1137	Serum amyloid Click for more detail	Gram-positive bacteria	MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY	122	Peptide	Natural	Play an important role in infectious inflammatory responses.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, DCs, B-lymphocytes	extracellular domains of leucine-rich repeat motifs	NA	NA	NA	significant role in the pathogenesis of severe inflammatory responses	NA	23985302	2013	NA
PRRID_1137	Serum amyloid Click for more detail	Gram-positive bacteria	MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY	122	Peptide	Natural	Play an important role in infectious inflammatory responses.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, DCs, B-lymphocytes	extracellular domains of leucine-rich repeat motifs	NA	NA	NA	significant role in the pathogenesis of severe inflammatory responses	NA	23985302	2013	NA
PRRID_1153	SNApin A Click for more detail	Endogenous (others)	MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK	136	Peptide	Natural	Play an important role in infectious inflammatory responses.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, DCs, B-lymphocytes	extracellular domains of leucine-rich repeat motifs	NA	NA	NA	significant role in the pathogenesis of severe inflammatory responses	NA	23985302	2013	NA
PRRID_1153	SNApin A Click for more detail	Endogenous (others)	MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK	136	Peptide	Natural	Play an important role in infectious inflammatory responses.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, DCs, B-lymphocytes	extracellular domains of leucine-rich repeat motifs	NA	NA	NA	significant role in the pathogenesis of severe inflammatory responses	NA	23985302	2013	NA
PRRID_1189	beta-defensin Click for more detail	Host (Endogenous) (others)	MKTHYFLLVMICFLFSQMEPGVGILTSLGRRTDQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS	69	Peptide	Natural	Defensins are cationic, microbicidal peptides active against many Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses	JNKBP1	Pattern recognition receptor (PRR)	TLR-deficient Mice on a C57BL/6	monocyte/macrophages	cell surface	Q9QUK6.fasta	Q9QUK6	835	TLR 4 leads to an intracellular signaling pathway NF-Œ∫B and inflammatory cytokine production which is responsible for activating the innate immune system	ELISA	24801735	2014	Pubchem_assay
PRRID_1189	beta-defensin Click for more detail	Host (Endogenous) (others)	MKTHYFLLVMICFLFSQMEPGVGILTSLGRRTDQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS	69	Peptide	Natural	Defensins are cationic, microbicidal peptides active against many Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses	JNKBP1	Pattern recognition receptor (PRR)	TLR-deficient Mice on a C57BL/6	monocyte/macrophages	cell surface	Q9QUK6.fasta	Q9QUK6	835	TLR 4 leads to an intracellular signaling pathway NF-Œ∫B and inflammatory cytokine production which is responsible for activating the innate immune system	ELISA	24801735	2014	Pubchem_assay
PRRID_1229	Defensins Click for more detail	Host (Endogenous) (others)	MKTHYFLLVMICFLFSQMEPGVGILTSLGRRTDQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS	69	Peptide	Natural	Defensins are cationic, microbicidal peptides active against many Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	Keratinocytes and mouse skin	cell surface	Q9QUK6.fasta	Q9QUK6	835	play a role in UVB induced immune suppression	NA	24786223	2014	Pubchem_assay
PRRID_1229	Defensins Click for more detail	Host (Endogenous) (others)	MKTHYFLLVMICFLFSQMEPGVGILTSLGRRTDQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS	69	Peptide	Natural	Defensins are cationic, microbicidal peptides active against many Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	Keratinocytes and mouse skin	cell surface	Q9QUK6.fasta	Q9QUK6	835	play a role in UVB induced immune suppression	NA	24786223	2014	Pubchem_assay
PRRID_1230	Defensins Click for more detail	Host (Endogenous) (others)	MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK	68	Peptide	Natural	Defensins are cationic, microbicidal peptides active against many Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Keratinocytes and mouse skin	cell surface	O00206.fasta	O00206	839	play a role in UVB induced immune suppression	NA	24786223	2014	Pubchem_assay
PRRID_1230	Defensins Click for more detail	Host (Endogenous) (others)	MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK	68	Peptide	Natural	Defensins are cationic, microbicidal peptides active against many Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Keratinocytes and mouse skin	cell surface	O00206.fasta	O00206	839	play a role in UVB induced immune suppression	NA	24786223	2014	Pubchem_assay
PRRID_1386	L-ornithine muramyl tripeptide Click for more detail	Gram-positive bacteria and some Gram-negative spirochaetes.	CCCCCCCCCCCCCCCC(=O)OC[C@H](COP(=O)(O)OCCNC(=O)[C@H](C)NC(=O)CC[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](C)O[C@@H]([C@H](O)[C@H](O)CO)[C@@H](NC(=O)C)C=O)C(=O)N)OC(=O)CCCCCCCCCCCCCCC	NA	Peptide	Natural	in vitro activates Nod	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Mice	immune cells like peripheral blood monocytes, granulocytes and dendritic cells, as well as in astrocytes of the brain and in paneth cells of the gut	intracellular receptors	Q8K3Z0.fasta	Q8K3Z0	1020	Nod2, are associ- ated with inflammatory bowel disease in humans	NA	24779390	2014	Pubchem_assay
PRRID_1386	L-ornithine muramyl tripeptide Click for more detail	Gram-positive bacteria and some Gram-negative spirochaetes.	CCCCCCCCCCCCCCCC(=O)OC[C@H](COP(=O)(O)OCCNC(=O)[C@H](C)NC(=O)CC[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](C)O[C@@H]([C@H](O)[C@H](O)CO)[C@@H](NC(=O)C)C=O)C(=O)N)OC(=O)CCCCCCCCCCCCCCC	NA	Peptide	Natural	in vitro activates Nod	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Mice	immune cells like peripheral blood monocytes, granulocytes and dendritic cells, as well as in astrocytes of the brain and in paneth cells of the gut	intracellular receptors	Q8K3Z0.fasta	Q8K3Z0	1020	Nod2, are associ- ated with inflammatory bowel disease in humans	NA	24779390	2014	Pubchem_assay
PRRID_1387	L-ornithine muramyl tripeptide Click for more detail	Gram-positive bacteria and some Gram-negative spirochaetes.	CCCCCCCCCCCCCCCC(=O)OC[C@H](COP(=O)(O)OCCNC(=O)[C@H](C)NC(=O)CC[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](C)O[C@@H]([C@H](O)[C@H](O)CO)[C@@H](NC(=O)C)C=O)C(=O)N)OC(=O)CCCCCCCCCCCCCCC	NA	Peptide	Natural	in vitro activates Nod	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Human	immune cells like peripheral blood monocytes, granulocytes and dendritic cells, as well as in astrocytes of the brain and in paneth cells of the gut	intracellular receptors	Q9HC29.fasta	Q9HC29	1040	Nod2, are associ- ated with inflammatory bowel disease in humans	NA	24779390	2014	Pubchem_assay
PRRID_1387	L-ornithine muramyl tripeptide Click for more detail	Gram-positive bacteria and some Gram-negative spirochaetes.	CCCCCCCCCCCCCCCC(=O)OC[C@H](COP(=O)(O)OCCNC(=O)[C@H](C)NC(=O)CC[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](C)O[C@@H]([C@H](O)[C@H](O)CO)[C@@H](NC(=O)C)C=O)C(=O)N)OC(=O)CCCCCCCCCCCCCCC	NA	Peptide	Natural	in vitro activates Nod	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Human	immune cells like peripheral blood monocytes, granulocytes and dendritic cells, as well as in astrocytes of the brain and in paneth cells of the gut	intracellular receptors	Q9HC29.fasta	Q9HC29	1040	Nod2, are associ- ated with inflammatory bowel disease in humans	NA	24779390	2014	Pubchem_assay
PRRID_1483	meso-diaminopomelic acid (meso- DAP) Click for more detail	Gram-negative bacteria and several Gram-positive bacteria such as Listeria and Bacillus spp	C(CC(C(=O)O)N)CC(C(=O)O)N	NA	Peptide	Natural	in vitro activates Nod1	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Human	macrophages and mesothelial cells	serine/threonine RIP2 (RICK, CARDIAK) kinase	Q9Y239.fasta	Q9Y239	953	Nod1 ligation also leads to the activation of NF-jB and MAPKs in neutrophils	ELISA	24766550	2014	Pubchem_assay
PRRID_1483	meso-diaminopomelic acid (meso- DAP) Click for more detail	Gram-negative bacteria and several Gram-positive bacteria such as Listeria and Bacillus spp	C(CC(C(=O)O)N)CC(C(=O)O)N	NA	Peptide	Natural	in vitro activates Nod1	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Human	macrophages and mesothelial cells	serine/threonine RIP2 (RICK, CARDIAK) kinase	Q9Y239.fasta	Q9Y239	953	Nod1 ligation also leads to the activation of NF-jB and MAPKs in neutrophils	ELISA	24766550	2014	Pubchem_assay
PRRID_1484	meso-lanthionine tripeptide Click for more detail	PGN of the anaerobic bacterium Fusobacterium nucleatum (Bacteria)	NA	NA	Peptide	Natural	in vitro activates Nod	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Mice	most adult tissues	intracellular receptors	Q8BHB0.fasta	Q8BHB0	953	play key roles in regulation of innate immune response. NLRs can cooperate with Toll-like receptors and regulate inflammatory and apoptotic response.	NA	24779390	2014	Pubchem_assay
PRRID_1484	meso-lanthionine tripeptide Click for more detail	PGN of the anaerobic bacterium Fusobacterium nucleatum (Bacteria)	NA	NA	Peptide	Natural	in vitro activates Nod	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Mice	most adult tissues	intracellular receptors	Q8BHB0.fasta	Q8BHB0	953	play key roles in regulation of innate immune response. NLRs can cooperate with Toll-like receptors and regulate inflammatory and apoptotic response.	NA	24779390	2014	Pubchem_assay
PRRID_1485	meso-lanthionine tripeptide Click for more detail	PGN of the anaerobic bacterium Fusobacterium nucleatum (Bacteria)	NA	NA	Peptide	Natural	in vitro activates Nod	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Human	most adult tissues	intracellular receptors	Q9Y239.fasta	Q9Y239	953	play key roles in regulation of innate immune response. NLRs can cooperate with Toll-like receptors and regulate inflammatory and apoptotic response.	NA	24779390	2014	Pubchem_assay
PRRID_1485	meso-lanthionine tripeptide Click for more detail	PGN of the anaerobic bacterium Fusobacterium nucleatum (Bacteria)	NA	NA	Peptide	Natural	in vitro activates Nod	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Human	most adult tissues	intracellular receptors	Q9Y239.fasta	Q9Y239	953	play key roles in regulation of innate immune response. NLRs can cooperate with Toll-like receptors and regulate inflammatory and apoptotic response.	NA	24779390	2014	Pubchem_assay
PRRID_1491	muramyl dipeptide (MDP) Click for more detail	Gram-positive and negative bacteria	CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptide	Natural	leads to cytokine activation, especially IL-1Œ± and IL-1Œ≤.	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Human	peripheral blood mononuclear cells such as macrophages, granulocytes, dendritic cells, and along the intestinal epithelial cells	intracellular receptors	Q9HC29.fasta	Q9HC29	1040	recognizes fragments of the bacterial cell wall.	Luciferase assay	24790089	2014	Pubchem_assay
PRRID_1491	muramyl dipeptide (MDP) Click for more detail	Gram-positive and negative bacteria	CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptide	Natural	leads to cytokine activation, especially IL-1Œ± and IL-1Œ≤.	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Human	peripheral blood mononuclear cells such as macrophages, granulocytes, dendritic cells, and along the intestinal epithelial cells	intracellular receptors	Q9HC29.fasta	Q9HC29	1040	recognizes fragments of the bacterial cell wall.	Luciferase assay	24790089	2014	Pubchem_assay
PRRID_1493	muramyl dipeptide (MDP) Click for more detail	Gram-negative and Gram-positive bacteria	CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptide	Natural	induces interleu- kin-8 (IL-8) production, CD62 ligand shedding, and CD11b up-regulation	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Mice	Neutrophils	serine/threonine RIP2 (RICK, CARDIAK) kinase	Q8K3Z0.fasta	Q8K3Z0	1020	involved in neutrophil immune responses in response to bacterial infection.	ELISA	24766550	2014	Pubchem_assay
PRRID_1493	muramyl dipeptide (MDP) Click for more detail	Gram-negative and Gram-positive bacteria	CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptide	Natural	induces interleu- kin-8 (IL-8) production, CD62 ligand shedding, and CD11b up-regulation	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Mice	Neutrophils	serine/threonine RIP2 (RICK, CARDIAK) kinase	Q8K3Z0.fasta	Q8K3Z0	1020	involved in neutrophil immune responses in response to bacterial infection.	ELISA	24766550	2014	Pubchem_assay
PRRID_1494	muramyl dipeptide (MDP) Click for more detail	Gram-negative and Gram-positive bacteria	CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptide	Natural	induces interleu- kin-8 (IL-8) production, CD62 ligand shedding, and CD11b up-regulation	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Human	Neutrophils	serine/threonine RIP2 (RICK, CARDIAK) kinase	Q8K3Z0.fasta	Q8K3Z0	1020	involved in neutrophil immune responses in response to bacterial infection.	ELISA	24766550	2014	Pubchem_assay
PRRID_1494	muramyl dipeptide (MDP) Click for more detail	Gram-negative and Gram-positive bacteria	CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptide	Natural	induces interleu- kin-8 (IL-8) production, CD62 ligand shedding, and CD11b up-regulation	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Human	Neutrophils	serine/threonine RIP2 (RICK, CARDIAK) kinase	Q8K3Z0.fasta	Q8K3Z0	1020	involved in neutrophil immune responses in response to bacterial infection.	ELISA	24766550	2014	Pubchem_assay
PRRID_1495	muramyl tripeptide Click for more detail	Mycobacteria (Bacteria)	CCCCCCCCCCCCCCCC(=O)OCC(COP(=O)(O)OCCNC(=O)C(C)NC(=O)CCC(C(=O)N)NC(=O)C(C)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C)OC(=O)CCCCCCCCCCCCCCC	NA	Peptide	Natural	in vitro activates Nod	PGLYRP-2	Peptidoglycan Recognition Receptor (PGRPs)	Mice	intraepithelial T lymphocytes	intracellular receptors	Q9JLF7.fasta	Q9JLF7	859	recognises peptidoglycan of bacterial cell wall	NA	24779390	2014	Pubchem_assay
PRRID_1495	muramyl tripeptide Click for more detail	Mycobacteria (Bacteria)	CCCCCCCCCCCCCCCC(=O)OCC(COP(=O)(O)OCCNC(=O)C(C)NC(=O)CCC(C(=O)N)NC(=O)C(C)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C)OC(=O)CCCCCCCCCCCCCCC	NA	Peptide	Natural	in vitro activates Nod	PGLYRP-2	Peptidoglycan Recognition Receptor (PGRPs)	Mice	intraepithelial T lymphocytes	intracellular receptors	Q9JLF7.fasta	Q9JLF7	859	recognises peptidoglycan of bacterial cell wall	NA	24779390	2014	Pubchem_assay
PRRID_1496	muramyl tripeptide Click for more detail	Mycobacteria (Bacteria)	CCCCCCCCCCCCCCCC(=O)OCC(COP(=O)(O)OCCNC(=O)C(C)NC(=O)CCC(C(=O)N)NC(=O)C(C)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C)OC(=O)CCCCCCCCCCCCCCC	NA	Peptide	Natural	in vitro activates Nod	PGLYRP-2	Peptidoglycan Recognition Receptor (PGRPs)	Human	intraepithelial T lymphocytes	intracellular receptors	Q96PD5.fasta	Q96PD5	576	recognises peptidoglycan of bacterial cell wall	NA	24779390	2014	Pubchem_assay
PRRID_1496	muramyl tripeptide Click for more detail	Mycobacteria (Bacteria)	CCCCCCCCCCCCCCCC(=O)OCC(COP(=O)(O)OCCNC(=O)C(C)NC(=O)CCC(C(=O)N)NC(=O)C(C)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C)OC(=O)CCCCCCCCCCCCCCC	NA	Peptide	Natural	in vitro activates Nod	PGLYRP-2	Peptidoglycan Recognition Receptor (PGRPs)	Human	intraepithelial T lymphocytes	intracellular receptors	Q96PD5.fasta	Q96PD5	576	recognises peptidoglycan of bacterial cell wall	NA	24779390	2014	Pubchem_assay
PRRID_1650	Tri-DAP Click for more detail	Gram-positive and negative bacteria	CC(C(=O)NC(CCC(=O)NC(CCCC(C(=O)O)N)C(=O)O)C(=O)O)N	NA	Peptide	Natural	activate NF-Œ∫B	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Mice	macrophages and mesothelial cells	serine/threonine RIP2 (RICK, CARDIAK) kinase	Q8BHB0.fasta	Q8BHB0	953	interacts with IKK to trigger the activation of NF-kB and the production of inflammatory cytokines, such as TNF-a and IL-6	ELISA	24766550	2014	Pubchem_assay
PRRID_1650	Tri-DAP Click for more detail	Gram-positive and negative bacteria	CC(C(=O)NC(CCC(=O)NC(CCCC(C(=O)O)N)C(=O)O)C(=O)O)N	NA	Peptide	Natural	activate NF-Œ∫B	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Mice	macrophages and mesothelial cells	serine/threonine RIP2 (RICK, CARDIAK) kinase	Q8BHB0.fasta	Q8BHB0	953	interacts with IKK to trigger the activation of NF-kB and the production of inflammatory cytokines, such as TNF-a and IL-6	ELISA	24766550	2014	Pubchem_assay
PRRID_1651	Tri-DAP Click for more detail	Gram-positive and negative bacteria	CC(C(=O)NC(CCC(=O)NC(CCCC(C(=O)O)N)C(=O)O)C(=O)O)N	NA	Peptide	Natural	activate NF-Œ∫B	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Human	macrophages and mesothelial cells	serine/threonine RIP2 (RICK, CARDIAK) kinase	Q8BHB0.fasta	Q8BHB0	953	interacts with IKK to trigger the activation of NF-kB and the production of inflammatory cytokines, such as TNF-a and IL-6	ELISA	24766550	2014	Pubchem_assay
PRRID_1651	Tri-DAP Click for more detail	Gram-positive and negative bacteria	CC(C(=O)NC(CCC(=O)NC(CCCC(C(=O)O)N)C(=O)O)C(=O)O)N	NA	Peptide	Natural	activate NF-Œ∫B	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Human	macrophages and mesothelial cells	serine/threonine RIP2 (RICK, CARDIAK) kinase	Q8BHB0.fasta	Q8BHB0	953	interacts with IKK to trigger the activation of NF-kB and the production of inflammatory cytokines, such as TNF-a and IL-6	ELISA	24766550	2014	Pubchem_assay

previous12 3 next