Browse result page of PRRDB 2.0

PRRID	Name of Ligand	Source of ligand	Sequence of Ligand	Length of Ligand	Type of Ligand	Occurence	Role of Ligand	Name of Receptor	Type of Reeptor	Source of the Receptor	Localization	Domain	Sequence of Receptor	Swiss prot ID	Length of receptor	Function of Receptor	Assay used	PMID	Year of publication	Pubchem assay
PRRID_0009	Acetylated LDL Click for more detail	Endogenous (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	Immunostimulant	Scavenger receptor A I (SR-A I)	Scavenger receptor (SR)	NA	NA	NA	NA	NA	NA	NA	NA	2300204	1991	NA
PRRID_0009	Acetylated LDL Click for more detail	Endogenous (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	Immunostimulant	Scavenger receptor A I (SR-A I)	Scavenger receptor (SR)	NA	NA	NA	NA	NA	NA	NA	NA	2300204	1991	NA
PRRID_0010	Advanced Glycation End Products (AGE) Click for more detail	Endogenous (others)	NA	NA	Lipoprotein	Natural	Immunostimulant	Scavenger receptor A I (SR-A I)	Scavenger receptor (SR)	NA	NA	NA	NA	NA	NA	NA	NA	2300204	1991	NA
PRRID_0010	Advanced Glycation End Products (AGE) Click for more detail	Endogenous (others)	NA	NA	Lipoprotein	Natural	Immunostimulant	Scavenger receptor A I (SR-A I)	Scavenger receptor (SR)	NA	NA	NA	NA	NA	NA	NA	NA	2300204	1991	NA
PRRID_0015	oxidized LDL (OxLDL) Click for more detail	Endogenous (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	Immunostimulant	Scavenger receptor A I (SR-A I)	Scavenger receptor (SR)	NA	NA	NA	NA	NA	NA	NA	NA	2300204	1991	NA
PRRID_0015	oxidized LDL (OxLDL) Click for more detail	Endogenous (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	Immunostimulant	Scavenger receptor A I (SR-A I)	Scavenger receptor (SR)	NA	NA	NA	NA	NA	NA	NA	NA	2300204	1991	NA
PRRID_0021	Acetylated LDL Click for more detail	Endogenous (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	Immunostimulant	cluster of differentiation 36 (CD36)	Pattern recognition receptor (PRR)	NA	NA	NA	NA	NA	NA	NA	NA	7685021	1993	NA
PRRID_0021	Acetylated LDL Click for more detail	Endogenous (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	Immunostimulant	cluster of differentiation 36 (CD36)	Pattern recognition receptor (PRR)	NA	NA	NA	NA	NA	NA	NA	NA	7685021	1993	NA
PRRID_0024	High Density Lipoprotein (HDL) Click for more detail	Endogenous (others)	CC(C)CCCC(C)C1CCC2C1(CCC3C2CC=C4C3(CCC(C4)O)C)C	NA	Lipoprotein	Natural	Immunostimulant	cluster of differentiation 36 (CD36)	Pattern recognition receptor (PRR)	NA	NA	NA	NA	NA	NA	NA	NA	7685021	1993	NA
PRRID_0024	High Density Lipoprotein (HDL) Click for more detail	Endogenous (others)	CC(C)CCCC(C)C1CCC2C1(CCC3C2CC=C4C3(CCC(C4)O)C)C	NA	Lipoprotein	Natural	Immunostimulant	cluster of differentiation 36 (CD36)	Pattern recognition receptor (PRR)	NA	NA	NA	NA	NA	NA	NA	NA	7685021	1993	NA
PRRID_0026	oxidized LDL (OxLDL) Click for more detail	Endogenous (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	Immunostimulant	cluster of differentiation 36 (CD36)	Pattern recognition receptor (PRR)	NA	NA	NA	NA	NA	NA	NA	NA	7685021	1993	NA
PRRID_0026	oxidized LDL (OxLDL) Click for more detail	Endogenous (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	Immunostimulant	cluster of differentiation 36 (CD36)	Pattern recognition receptor (PRR)	NA	NA	NA	NA	NA	NA	NA	NA	7685021	1993	NA
PRRID_0032	Acetylated LDL Click for more detail	Endogenous (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	Immunostimulant	dSR-C1	Scavenger receptor (SR)	Drosophila melanogaster	NA	two complement control protein (CCP) domains and somatomedin B, MAM, and mucin-like domains	NA	NA	NA	NA	NA	7732030	1995	NA
PRRID_0032	Acetylated LDL Click for more detail	Endogenous (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	Immunostimulant	dSR-C1	Scavenger receptor (SR)	Drosophila melanogaster	NA	two complement control protein (CCP) domains and somatomedin B, MAM, and mucin-like domains	NA	NA	NA	NA	NA	7732030	1995	NA
PRRID_0033	Acetylated LDL Click for more detail	NA	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	Acetylated LDL is a potent ligand for MARCO	Macrophage receptor with collagenous structure (MARCO)	Scavenger receptor (SR)	Mice	Macrophages	NA	A2RT24.fasta	A2RT24	518	It plays a role in immunological reactions.	Immunoprecipitation	7867067	1995	Pubchem Assay
PRRID_0033	Acetylated LDL Click for more detail	NA	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	Acetylated LDL is a potent ligand for MARCO	Macrophage receptor with collagenous structure (MARCO)	Scavenger receptor (SR)	Mice	Macrophages	NA	A2RT24.fasta	A2RT24	518	It plays a role in immunological reactions.	Immunoprecipitation	7867067	1995	Pubchem Assay
PRRID_0034	Acetylated LDL Click for more detail	Host (Endogenous) (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	Acetylated-LDL is a potent activator of MSR.	Macrophage Scavenger Receptor (MSR)	Scavenger receptor (SR)	Human	Macrophages	NA	P21757.fasta	P21757	451	The MSR mediates the endocytic uptake and degradation of LDL.	NA	7607209	1995	Pubchem Assay
PRRID_0034	Acetylated LDL Click for more detail	Host (Endogenous) (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	Acetylated-LDL is a potent activator of MSR.	Macrophage Scavenger Receptor (MSR)	Scavenger receptor (SR)	Human	Macrophages	NA	P21757.fasta	P21757	451	The MSR mediates the endocytic uptake and degradation of LDL.	NA	7607209	1995	Pubchem Assay
PRRID_0055	Acetylated LDL Click for more detail	Endogenous (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	Immunostimulant	Scavenger receptor expressed by endothelial cells 1	Scavenger receptor (SR)	Chinese Hamster	Chinese hamster ovary cells	Lectin-like domains	NA	NA	NA	NA	ELISA	9395444	1997	NA
PRRID_0055	Acetylated LDL Click for more detail	Endogenous (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	Immunostimulant	Scavenger receptor expressed by endothelial cells 1	Scavenger receptor (SR)	Chinese Hamster	Chinese hamster ovary cells	Lectin-like domains	NA	NA	NA	NA	ELISA	9395444	1997	NA
PRRID_0056	Acetylated LDL Click for more detail	Endogenous (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	Immunostimulant	Lectin-like oxidized LDLreceptor 1	C type Lectin (CTL/CLR)	NA	vascular endothelium and vascular-rich organs.	NA	NA	NA	NA	NA	NA	9052782	1997	NA
PRRID_0056	Acetylated LDL Click for more detail	Endogenous (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	Immunostimulant	Lectin-like oxidized LDLreceptor 1	C type Lectin (CTL/CLR)	NA	vascular endothelium and vascular-rich organs.	NA	NA	NA	NA	NA	NA	9052782	1997	NA
PRRID_0057	Acetylated LDL Click for more detail	Endogenous (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	elicit innate immune response	Scavenger receptor A II	Scavenger receptor (SR)	Mice	Macrophages	NA	Q08857.fasta	Q08857	472	production of pro-inflammatory cytokines	NA	9069289	1997	Pubchem Assay
PRRID_0057	Acetylated LDL Click for more detail	Endogenous (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	elicit innate immune response	Scavenger receptor A II	Scavenger receptor (SR)	Mice	Macrophages	NA	Q08857.fasta	Q08857	472	production of pro-inflammatory cytokines	NA	9069289	1997	Pubchem Assay
PRRID_0062	oxidized LDL (OxLDL) Click for more detail	Endogenous (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	Immunostimulant	Scavenger receptor expressed by endothelial cells 1	Scavenger receptor (SR)	Chinese Hamster	Chinese hamster ovary cells	Lectin-like domains	NA	NA	NA	NA	ELISA	9395444	1997	NA
PRRID_0062	oxidized LDL (OxLDL) Click for more detail	Endogenous (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	Immunostimulant	Scavenger receptor expressed by endothelial cells 1	Scavenger receptor (SR)	Chinese Hamster	Chinese hamster ovary cells	Lectin-like domains	NA	NA	NA	NA	ELISA	9395444	1997	NA
PRRID_0063	oxidized LDL (OxLDL) Click for more detail	Endogenous (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	Immunostimulant	Lectin-like oxidized LDLreceptor 1	C type Lectin (CTL/CLR)	NA	vascular endothelium and vascular-rich organs.	NA	NA	NA	NA	NA	NA	9052782	1997	NA
PRRID_0063	oxidized LDL (OxLDL) Click for more detail	Endogenous (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	Immunostimulant	Lectin-like oxidized LDLreceptor 1	C type Lectin (CTL/CLR)	NA	vascular endothelium and vascular-rich organs.	NA	NA	NA	NA	NA	NA	9052782	1997	NA
PRRID_0064	oxidized LDL (OxLDL) Click for more detail	Endogenous (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	elicit innate immune response	Scavenger receptor A II	Scavenger receptor (SR)	Mice	Macrophages	NA	Q08857.fasta	Q08857	472	production of pro-inflammatory cytokines	NA	9069289	1997	Pubchem Assay
PRRID_0064	oxidized LDL (OxLDL) Click for more detail	Endogenous (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	elicit innate immune response	Scavenger receptor A II	Scavenger receptor (SR)	Mice	Macrophages	NA	Q08857.fasta	Q08857	472	production of pro-inflammatory cytokines	NA	9069289	1997	Pubchem Assay
PRRID_0065	Acetylated LDL Click for more detail	Host (Endogenous) (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	AcLDL pretreatment increased expression of macrosialin	Microsialin	Scavenger receptor (SR)	Mice	Peritoneal macrophages	NA	A0A0R4J1C8.fasta	A0A0R4J1C8	335	It leads to the binding and uptake of oxidised form of LDL by resident mouse peritoneal macrophages.	Endocytic degradation assays	9598839	1998	Pubchem Assay
PRRID_0065	Acetylated LDL Click for more detail	Host (Endogenous) (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	AcLDL pretreatment increased expression of macrosialin	Microsialin	Scavenger receptor (SR)	Mice	Peritoneal macrophages	NA	A0A0R4J1C8.fasta	A0A0R4J1C8	335	It leads to the binding and uptake of oxidised form of LDL by resident mouse peritoneal macrophages.	Endocytic degradation assays	9598839	1998	Pubchem Assay
PRRID_0068	High Density Lipoprotein (HDL) Click for more detail	Host (Endogenous) (others)	CC(C)CCCC(C)C1CCC2C1(CCC3C2CC=C4C3(CCC(C4)O)C)C	NA	Lipoprotein	Natural	CD36 is a high affinity receptor for the native lipoproteins LDL.	cluster of differentiation 36 (CD36)	Pattern recognition receptor (PRR)	Human	Monocytes/Macrophages	NA	P16671.fasta	P16671	472	Lipoprotein binding assay	NA	9555943	1998	Pubchem Assay
PRRID_0068	High Density Lipoprotein (HDL) Click for more detail	Host (Endogenous) (others)	CC(C)CCCC(C)C1CCC2C1(CCC3C2CC=C4C3(CCC(C4)O)C)C	NA	Lipoprotein	Natural	CD36 is a high affinity receptor for the native lipoproteins LDL.	cluster of differentiation 36 (CD36)	Pattern recognition receptor (PRR)	Human	Monocytes/Macrophages	NA	P16671.fasta	P16671	472	Lipoprotein binding assay	NA	9555943	1998	Pubchem Assay
PRRID_0069	Low Density Lipoprotein (LDL) Click for more detail	Host (Endogenous) (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	CD36 is a high affinity receptor for the native lipoproteins HDL.	cluster of differentiation 36 (CD36)	Pattern recognition receptor (PRR)	Human	Monocytes/Macrophages	NA	P16671.fasta	P16671	472	Lipoprotein binding assay	NA	9555943	1998	Pubchem Assay
PRRID_0069	Low Density Lipoprotein (LDL) Click for more detail	Host (Endogenous) (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	CD36 is a high affinity receptor for the native lipoproteins HDL.	cluster of differentiation 36 (CD36)	Pattern recognition receptor (PRR)	Human	Monocytes/Macrophages	NA	P16671.fasta	P16671	472	Lipoprotein binding assay	NA	9555943	1998	Pubchem Assay
PRRID_0070	Minimally oxidized LDL (MM-LDL) Click for more detail	Host (Endogenous) (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	MM-LDL pretreatment induced a clear increase of cell association and increase both mRNAlevels and protein levels of scavenger receptor A, CD36, and macrosialin.	Microsialin	Scavenger receptor (SR)	Mice	Peritoneal macrophages	NA	A0A0R4J1C8.fasta	A0A0R4J1C8	335	It leads to the binding and uptake of oxidised form of LDL by resident mouse peritoneal macrophages.	Endocytic degradation assays	9598839	1998	Pubchem Assay
PRRID_0070	Minimally oxidized LDL (MM-LDL) Click for more detail	Host (Endogenous) (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	MM-LDL pretreatment induced a clear increase of cell association and increase both mRNAlevels and protein levels of scavenger receptor A, CD36, and macrosialin.	Microsialin	Scavenger receptor (SR)	Mice	Peritoneal macrophages	NA	A0A0R4J1C8.fasta	A0A0R4J1C8	335	It leads to the binding and uptake of oxidised form of LDL by resident mouse peritoneal macrophages.	Endocytic degradation assays	9598839	1998	Pubchem Assay
PRRID_0071	oxidized LDL (OxLDL) Click for more detail	Host (Endogenous) (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	OxLDL pretreatment increased expression of macrosialin.	Microsialin	Scavenger receptor (SR)	Mice	Peritoneal macrophages	NA	A0A0R4J1C8.fasta	A0A0R4J1C8	335	It leads to the binding and uptake of oxidised form of LDL by resident mouse peritoneal macrophages.	Endocytic degradation assays	9598839	1998	Pubchem Assay
PRRID_0071	oxidized LDL (OxLDL) Click for more detail	Host (Endogenous) (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	OxLDL pretreatment increased expression of macrosialin.	Microsialin	Scavenger receptor (SR)	Mice	Peritoneal macrophages	NA	A0A0R4J1C8.fasta	A0A0R4J1C8	335	It leads to the binding and uptake of oxidised form of LDL by resident mouse peritoneal macrophages.	Endocytic degradation assays	9598839	1998	Pubchem Assay
PRRID_0072	Very Low Density Lipoprotein (VLDL) Click for more detail	Host (Endogenous) (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	CD36 is a high affinity receptor for the native lipoproteins VLDL.	cluster of differentiation 36 (CD36)	Pattern recognition receptor (PRR)	Human	Monocytes/Macrophages	NA	P16671.fasta	P16671	472	Lipoprotein binding assay	NA	9555943	1998	Pubchem Assay
PRRID_0072	Very Low Density Lipoprotein (VLDL) Click for more detail	Host (Endogenous) (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	CD36 is a high affinity receptor for the native lipoproteins VLDL.	cluster of differentiation 36 (CD36)	Pattern recognition receptor (PRR)	Human	Monocytes/Macrophages	NA	P16671.fasta	P16671	472	Lipoprotein binding assay	NA	9555943	1998	Pubchem Assay
PRRID_0076	Acetylated LDL Click for more detail	Host (Endogenous) (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	It binds to the CD36 with high affinity	cluster of differentiation 36 (CD36)	Pattern recognition receptor (PRR)	Human	CHO cells	NA	P16671.fasta	P16671	472	CD36 mediates the endocytic uptake and subsequent intracellular degradation.	Cellular assay	11035013	2000	Pubchem Assay
PRRID_0076	Acetylated LDL Click for more detail	Host (Endogenous) (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	It binds to the CD36 with high affinity	cluster of differentiation 36 (CD36)	Pattern recognition receptor (PRR)	Human	CHO cells	NA	P16671.fasta	P16671	472	CD36 mediates the endocytic uptake and subsequent intracellular degradation.	Cellular assay	11035013	2000	Pubchem Assay
PRRID_0085	High Density Lipoprotein (HDL) Click for more detail	Host (Endogenous) (others)	CC(C)CCCC(C)C1CCC2C1(CCC3C2CC=C4C3(CCC(C4)O)C)C	NA	Lipoprotein	Natural	It binds to the CD36 with high affinity	cluster of differentiation 36 (CD36)	Pattern recognition receptor (PRR)	Human	CHO cells	NA	P16671.fasta	P16671	472	CD36 mediates the endocytic uptake and subsequent intracellular degradation.	Cellular assay	11035013	2000	Pubchem Assay
PRRID_0085	High Density Lipoprotein (HDL) Click for more detail	Host (Endogenous) (others)	CC(C)CCCC(C)C1CCC2C1(CCC3C2CC=C4C3(CCC(C4)O)C)C	NA	Lipoprotein	Natural	It binds to the CD36 with high affinity	cluster of differentiation 36 (CD36)	Pattern recognition receptor (PRR)	Human	CHO cells	NA	P16671.fasta	P16671	472	CD36 mediates the endocytic uptake and subsequent intracellular degradation.	Cellular assay	11035013	2000	Pubchem Assay
PRRID_0091	oxidized LDL (OxLDL) Click for more detail	Host (Endogenous) (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	Ox-LDL binds with SR-PSOX with high affinity.	Scavenger receptor PSOX (SR-PSOX)	Scavenger receptor (SR)	PMA treated THP-1 cells	Macrophages	NA	NA	NA	NA	SR-PSOX specifically binds with high affinity, internalize and degrade OxLDL, hence play important roles in pathophysiology including atherogenesis.	ELISA	11060282	2000	NA
PRRID_0091	oxidized LDL (OxLDL) Click for more detail	Host (Endogenous) (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	Ox-LDL binds with SR-PSOX with high affinity.	Scavenger receptor PSOX (SR-PSOX)	Scavenger receptor (SR)	PMA treated THP-1 cells	Macrophages	NA	NA	NA	NA	SR-PSOX specifically binds with high affinity, internalize and degrade OxLDL, hence play important roles in pathophysiology including atherogenesis.	ELISA	11060282	2000	NA
PRRID_0092	oxidized LDL (OxLDL) Click for more detail	Host (Endogenous) (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	Ox-LDL binds with SR-PSOX with high affinity.	Scavenger receptor PSOX (SR-PSOX)	Scavenger receptor (SR)	Human	Macrophages	NA	Q9H2A7.fasta	Q9H2A7	254	SR-PSOX specifically binds with high affinity, internalize and degrade OxLDL, hence play important roles in pathophysiology including atherogenesis.	ELISA	11060282	2000	Pubchem Assay
PRRID_0092	oxidized LDL (OxLDL) Click for more detail	Host (Endogenous) (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	Ox-LDL binds with SR-PSOX with high affinity.	Scavenger receptor PSOX (SR-PSOX)	Scavenger receptor (SR)	Human	Macrophages	NA	Q9H2A7.fasta	Q9H2A7	254	SR-PSOX specifically binds with high affinity, internalize and degrade OxLDL, hence play important roles in pathophysiology including atherogenesis.	ELISA	11060282	2000	Pubchem Assay
PRRID_0093	oxidized LDL (OxLDL) Click for more detail	Host (Endogenous) (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	It binds to the CD36 with high affinity	cluster of differentiation 36 (CD36)	Pattern recognition receptor (PRR)	Human	CHO cells	NA	P16671.fasta	P16671	472	CD36 mediates the endocytic uptake and subsequent intracellular degradation.	Cellular assay	11035013	2000	Pubchem Assay
PRRID_0093	oxidized LDL (OxLDL) Click for more detail	Host (Endogenous) (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	It binds to the CD36 with high affinity	cluster of differentiation 36 (CD36)	Pattern recognition receptor (PRR)	Human	CHO cells	NA	P16671.fasta	P16671	472	CD36 mediates the endocytic uptake and subsequent intracellular degradation.	Cellular assay	11035013	2000	Pubchem Assay
PRRID_0103	Hypochlorite modified HDL Click for more detail	Endogenous (others)	CC(C)CCCC(C)C1CCC2C1(CCC3C2CC=C4C3(CCC(C4)O)C)C	NA	Lipoprotein	Natural	Immunostimulant	Lectin-like oxidized LDLreceptor 1	C type Lectin (CTL/CLR)	NA	NA	NA	NA	NA	NA	induces pro-inflammatory cytokine response	NA	11292679	2001	NA
PRRID_0103	Hypochlorite modified HDL Click for more detail	Endogenous (others)	CC(C)CCCC(C)C1CCC2C1(CCC3C2CC=C4C3(CCC(C4)O)C)C	NA	Lipoprotein	Natural	Immunostimulant	Lectin-like oxidized LDLreceptor 1	C type Lectin (CTL/CLR)	NA	NA	NA	NA	NA	NA	induces pro-inflammatory cytokine response	NA	11292679	2001	NA
PRRID_0109	oxidized LDL (OxLDL) Click for more detail	Endogenous (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Synthetic	Ox-LDL binds with SR-PSOX with high affinity.	Scavenger Receptor for PhosphatidylSerine and Oxidized lipoprotein (SR-PSOX)	Scavenger receptor (SR)	Human	Macrophages	NA	Q9H2A7.fasta	Q9H2A7	254	SR-PSOX is involved in Ox-LDL uptake and subsequent foam cell transformation in macrophages in vivo and thus may play important roles in human atherosclerotic lesion formation.	ELISA	11701468	2001	Pubchem Assay
PRRID_0109	oxidized LDL (OxLDL) Click for more detail	Endogenous (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Synthetic	Ox-LDL binds with SR-PSOX with high affinity.	Scavenger Receptor for PhosphatidylSerine and Oxidized lipoprotein (SR-PSOX)	Scavenger receptor (SR)	Human	Macrophages	NA	Q9H2A7.fasta	Q9H2A7	254	SR-PSOX is involved in Ox-LDL uptake and subsequent foam cell transformation in macrophages in vivo and thus may play important roles in human atherosclerotic lesion formation.	ELISA	11701468	2001	Pubchem Assay
PRRID_0132	Hypochlorite modified HDL Click for more detail	Host (Endogenous) (others)	CC(C)CCCC(C)C1CCC2C1(CCC3C2CC=C4C3(CCC(C4)O)C)C	NA	Lipoprotein	Natural	It has a high affinity for the Lectin-like oxidized low density lipoprotein receptor 1 (LOX-1).	Lectin-like oxidized LDLreceptor 1	C type Lectin (CTL/CLR)	Mice (Murine)	CHO Cells‚ÄîldlA cells	NA	Q9EQ09.fasta	Q9EQ09	363	It impairs high density lipoprotein-dependent selective lipid uptake and reverse cholesterol transport.	NA	12070141	2002	Pubchem Assay
PRRID_0132	Hypochlorite modified HDL Click for more detail	Host (Endogenous) (others)	CC(C)CCCC(C)C1CCC2C1(CCC3C2CC=C4C3(CCC(C4)O)C)C	NA	Lipoprotein	Natural	It has a high affinity for the Lectin-like oxidized low density lipoprotein receptor 1 (LOX-1).	Lectin-like oxidized LDLreceptor 1	C type Lectin (CTL/CLR)	Mice (Murine)	CHO Cells‚ÄîldlA cells	NA	Q9EQ09.fasta	Q9EQ09	363	It impairs high density lipoprotein-dependent selective lipid uptake and reverse cholesterol transport.	NA	12070141	2002	Pubchem Assay
PRRID_0133	Hypochlorite modified HDL Click for more detail	Host (Endogenous) (others)	CC(C)CCCC(C)C1CCC2C1(CCC3C2CC=C4C3(CCC(C4)O)C)C	NA	Lipoprotein	Natural	It has a high affinity for the Lectin-like oxidized low density lipoprotein receptor 1 (LOX-1).	Scavenger receptor class B, type I (SR-BI)	Scavenger receptor (SR)	Mice (Murine)	CHO Cells‚ÄîldlA cells	NA	Q06BI8.fasta	Q06BI8	494	It impairs high density lipoprotein-dependent selective lipid uptake and reverse cholesterol transport.	NA	12070141	2002	Pubchem Assay
PRRID_0133	Hypochlorite modified HDL Click for more detail	Host (Endogenous) (others)	CC(C)CCCC(C)C1CCC2C1(CCC3C2CC=C4C3(CCC(C4)O)C)C	NA	Lipoprotein	Natural	It has a high affinity for the Lectin-like oxidized low density lipoprotein receptor 1 (LOX-1).	Scavenger receptor class B, type I (SR-BI)	Scavenger receptor (SR)	Mice (Murine)	CHO Cells‚ÄîldlA cells	NA	Q06BI8.fasta	Q06BI8	494	It impairs high density lipoprotein-dependent selective lipid uptake and reverse cholesterol transport.	NA	12070141	2002	Pubchem Assay
PRRID_0143	OspA Click for more detail	Borrelia burgdorferi(Bacteria)	MKKYLLGIGLILALIACKQNVSSLDEKNSVSVDLPGGMTVLVSKEKDKDGKYSLDATVDKLELKGTSDKNNGSGTLEGEKTDKSKVKLTIADDLSQTKFEIFKEDGKTLVSKKVTLKDKSSTEEKFNEKGETSEKTIVRANGTRLEYTDIKSDGSGKAKEVLKDFTLEGTLAADGKTTLKVTEGTVVLSKNILKSGEITVALDDSDTTQATKKTGNWDSKSSTLTISVNSQKTKNLVFTKEDTITVQKYDSAGTNLEGKAVEITTLKELKAALK	NA	Lipoprotein	Natural	immunostimulantt	Toll-like receptor 2 (TLR2)+unknown	Toll-like receptor (TLR)	Human	NA	NA	NA	NA	NA	human hyporesponsiveness to OspA vaccination	NA	12091878	2002	NA
PRRID_0143	OspA Click for more detail	Borrelia burgdorferi(Bacteria)	MKKYLLGIGLILALIACKQNVSSLDEKNSVSVDLPGGMTVLVSKEKDKDGKYSLDATVDKLELKGTSDKNNGSGTLEGEKTDKSKVKLTIADDLSQTKFEIFKEDGKTLVSKKVTLKDKSSTEEKFNEKGETSEKTIVRANGTRLEYTDIKSDGSGKAKEVLKDFTLEGTLAADGKTTLKVTEGTVVLSKNILKSGEITVALDDSDTTQATKKTGNWDSKSSTLTISVNSQKTKNLVFTKEDTITVQKYDSAGTNLEGKAVEITTLKELKAALK	NA	Lipoprotein	Natural	immunostimulantt	Toll-like receptor 2 (TLR2)+unknown	Toll-like receptor (TLR)	Human	NA	NA	NA	NA	NA	human hyporesponsiveness to OspA vaccination	NA	12091878	2002	NA
PRRID_0257	Lipoprotein Click for more detail	Gram-negative and Gram-positive bacteria	NA	NA	Lipoprotein	Natural	elicit innate immune response	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Peripheral blood mononuclear cells (PBMC)	cytoplasmic leucine rich repeat (LRR)	Q9QUN7.fasta	Q9QUN7	784	plays a fundamental role in¬†pathogen¬†recognition and activation of¬†innate immunity	ELISA	17353199	2007	Pubchem Assay
PRRID_0257	Lipoprotein Click for more detail	Gram-negative and Gram-positive bacteria	NA	NA	Lipoprotein	Natural	elicit innate immune response	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Peripheral blood mononuclear cells (PBMC)	cytoplasmic leucine rich repeat (LRR)	Q9QUN7.fasta	Q9QUN7	784	plays a fundamental role in¬†pathogen¬†recognition and activation of¬†innate immunity	ELISA	17353199	2007	Pubchem Assay
PRRID_0258	Lipoprotein Click for more detail	Bacteria	NA	NA	Lipoprotein	Natural	elicit innate immune response	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	BALB/c and C57BL/6 mice	Spleen cells	Toll- IL-1R domain	Q9QUN7.fasta	Q9QUN7	784	plays a fundamental role in¬†pathogen¬†recognition and activation of¬†innate immunity	NA	17404301	2007	Pubchem Assay
PRRID_0258	Lipoprotein Click for more detail	Bacteria	NA	NA	Lipoprotein	Natural	elicit innate immune response	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	BALB/c and C57BL/6 mice	Spleen cells	Toll- IL-1R domain	Q9QUN7.fasta	Q9QUN7	784	plays a fundamental role in¬†pathogen¬†recognition and activation of¬†innate immunity	NA	17404301	2007	Pubchem Assay
PRRID_0260	N-ALP1 Click for more detail	Mycoplasma pneumoniae (Bacteria)	NA	NA	Lipoprotein	Natural	It induces the activation of NF-kappaB and induces the expression levels of interleukin-6 (IL-6) and tumour necrosis factor-alpha (TNF-alpha).	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	human kidney cell line, 293T	NA	NA	NA	NA	It has the role in immuno inflammation.	Transfection and luciferase assay	17433078	2007	NA
PRRID_0260	N-ALP1 Click for more detail	Mycoplasma pneumoniae (Bacteria)	NA	NA	Lipoprotein	Natural	It induces the activation of NF-kappaB and induces the expression levels of interleukin-6 (IL-6) and tumour necrosis factor-alpha (TNF-alpha).	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	human kidney cell line, 293T	NA	NA	NA	NA	It has the role in immuno inflammation.	Transfection and luciferase assay	17433078	2007	NA
PRRID_0261	N-ALP2 Click for more detail	Mycoplasma pneumoniae (Bacteria)	NA	NA	Lipoprotein	Natural	It induces the activation of NF-kappaB and induces the expression levels of interleukin-6 (IL-6) and tumour necrosis factor-alpha (TNF-alpha).	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	human kidney cell line, 293T	NA	NA	NA	NA	It has the role in immuno inflammation.	Transfection and luciferase assay	17433078	2007	NA
PRRID_0261	N-ALP2 Click for more detail	Mycoplasma pneumoniae (Bacteria)	NA	NA	Lipoprotein	Natural	It induces the activation of NF-kappaB and induces the expression levels of interleukin-6 (IL-6) and tumour necrosis factor-alpha (TNF-alpha).	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	human kidney cell line, 293T	NA	NA	NA	NA	It has the role in immuno inflammation.	Transfection and luciferase assay	17433078	2007	NA
PRRID_0287	FTT1103 Click for more detail	Mycoplasma pneumoniae (Bacteria)	NA	NA	Lipoprotein	Natural	Immunostimulant	Toll-like receptor 2 (TLR2)/Toll-like receptor (TLR1	Toll-like receptor (TLR)	Human	NA	NA	NA	NA	NA	capable of stimulating a proinflammatory response and the cellular receptors they trigger	NA	18079113	2008	NA
PRRID_0287	FTT1103 Click for more detail	Mycoplasma pneumoniae (Bacteria)	NA	NA	Lipoprotein	Natural	Immunostimulant	Toll-like receptor 2 (TLR2)/Toll-like receptor (TLR1	Toll-like receptor (TLR)	Human	NA	NA	NA	NA	NA	capable of stimulating a proinflammatory response and the cellular receptors they trigger	NA	18079113	2008	NA
PRRID_0311	Lipoprotein Click for more detail	Ureaplasma parvum (Bacteria)	NA	NA	Lipoprotein	Natural	Upon ligand engagement TLR proteins trigger downstream cellular signaling, leads to the activation of NF-	Toll-like receptor 1 (TLR1)	Toll-like receptor (TLR)	Human	Kidney cell line, 293T	LRR	Q15399.fasta	Q15399	786	This induces the inflammatory response.	ELISA	18451040	2008	Pubchem Assay
PRRID_0311	Lipoprotein Click for more detail	Ureaplasma parvum (Bacteria)	NA	NA	Lipoprotein	Natural	Upon ligand engagement TLR proteins trigger downstream cellular signaling, leads to the activation of NF-	Toll-like receptor 1 (TLR1)	Toll-like receptor (TLR)	Human	Kidney cell line, 293T	LRR	Q15399.fasta	Q15399	786	This induces the inflammatory response.	ELISA	18451040	2008	Pubchem Assay
PRRID_0312	Lipoprotein Click for more detail	Ureaplasma parvum (Bacteria)	NA	NA	Lipoprotein	Natural	Upon ligand engagement TLR proteins trigger downstream cellular signaling, leads to the activation of NF-	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Kidney cell line, 293T	LRR	O60603.fasta	O60603	784	This induces the inflammatory response.	ELISA	18451040	2008	Pubchem Assay
PRRID_0312	Lipoprotein Click for more detail	Ureaplasma parvum (Bacteria)	NA	NA	Lipoprotein	Natural	Upon ligand engagement TLR proteins trigger downstream cellular signaling, leads to the activation of NF-	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Kidney cell line, 293T	LRR	O60603.fasta	O60603	784	This induces the inflammatory response.	ELISA	18451040	2008	Pubchem Assay
PRRID_0313	Lipoprotein Click for more detail	Ureaplasma parvum (Bacteria)	NA	NA	Lipoprotein	Natural	Upon ligand engagement TLR proteins trigger downstream cellular signaling, leads to the activation of NF-	Toll-like receptor 6 (TLR6)	Toll-like receptor (TLR)	Human	Kidney cell line, 293T	LRR	Q9Y2C9.fasta	Q9Y2C9	796	This induces the inflammatory response.	ELISA	18451040	2008	Pubchem Assay
PRRID_0313	Lipoprotein Click for more detail	Ureaplasma parvum (Bacteria)	NA	NA	Lipoprotein	Natural	Upon ligand engagement TLR proteins trigger downstream cellular signaling, leads to the activation of NF-	Toll-like receptor 6 (TLR6)	Toll-like receptor (TLR)	Human	Kidney cell line, 293T	LRR	Q9Y2C9.fasta	Q9Y2C9	796	This induces the inflammatory response.	ELISA	18451040	2008	Pubchem Assay
PRRID_0314	Lipoprotein Click for more detail	Listeria monocytogenes (Bacteria)	NA	NA	Lipoprotein	Natural	It leads to the activation of NF-Œ∫B and stimulates the production of proinflammatory cytokines such as TNF-alpha and IL-6.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Bone marrow-derived DC	NA	Q9QUN7.fasta	Q9QUN7	784	It has a immunostimulatory role	Cytokines assay	18641340	2008	Pubchem Assay
PRRID_0314	Lipoprotein Click for more detail	Listeria monocytogenes (Bacteria)	NA	NA	Lipoprotein	Natural	It leads to the activation of NF-Œ∫B and stimulates the production of proinflammatory cytokines such as TNF-alpha and IL-6.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Bone marrow-derived DC	NA	Q9QUN7.fasta	Q9QUN7	784	It has a immunostimulatory role	Cytokines assay	18641340	2008	Pubchem Assay
PRRID_0327	MG149 Click for more detail	Mycoplasma genitalium (Bacteria)	CCCCCCCC1=CC=C(C=C1)CCC2=C(C(=CC=C2)O)C(=O)O	NA	Lipoprotein	Natural	On binding to the TLR2, it induces the activation of NF-	Toll-like receptor (TLR1 and Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Kidney cell line, 293T	LRR	NA	NA	NA	It has a immunostimulatory role	ELISA	18474641	2008	NA
PRRID_0327	MG149 Click for more detail	Mycoplasma genitalium (Bacteria)	CCCCCCCC1=CC=C(C=C1)CCC2=C(C(=CC=C2)O)C(=O)O	NA	Lipoprotein	Natural	On binding to the TLR2, it induces the activation of NF-	Toll-like receptor (TLR1 and Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Kidney cell line, 293T	LRR	NA	NA	NA	It has a immunostimulatory role	ELISA	18474641	2008	NA
PRRID_0345	SalP Click for more detail	Bacteria	NA	NA	Lipoprotein	Natural	Immunostimulant	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	human corneal epithelial	NA	O60603.fasta	O60603	784	NA	Western Blot analysis	18191935	2008	Pubchem Assay
PRRID_0345	SalP Click for more detail	Bacteria	NA	NA	Lipoprotein	Natural	Immunostimulant	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	human corneal epithelial	NA	O60603.fasta	O60603	784	NA	Western Blot analysis	18191935	2008	Pubchem Assay
PRRID_0351	TUL4 Click for more detail	Mycoplasma pneumoniae (Bacteria)	NA	NA	Lipoprotein	Natural	Immunostimulant	Toll-like receptor 2 (TLR2)/Toll-like receptor (TLR1	Toll-like receptor (TLR)	Human	NA	NA	NA	NA	NA	capable of stimulating a proinflammatory response and the cellular receptors they trigger	NA	18079113	2008	NA
PRRID_0351	TUL4 Click for more detail	Mycoplasma pneumoniae (Bacteria)	NA	NA	Lipoprotein	Natural	Immunostimulant	Toll-like receptor 2 (TLR2)/Toll-like receptor (TLR1	Toll-like receptor (TLR)	Human	NA	NA	NA	NA	NA	capable of stimulating a proinflammatory response and the cellular receptors they trigger	NA	18079113	2008	NA
PRRID_0370	Lipoprotein Click for more detail	S. gordonii (Bacteria)	NA	NA	Lipoprotein	Natural	Stimulation elicits the production of tumour necrosis factor (TNF) and interleukin (IL)-6.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice (Murine)	Bone-marrow derived Dendritic cells	LRR	Q9QUN7.fasta	Q9QUN7	784	This activation can be attributed to multiple immunostimulatory components present within S. gordonii bacterial cells.	ELISA	19284500	2009	Pubchem Assay
PRRID_0370	Lipoprotein Click for more detail	S. gordonii (Bacteria)	NA	NA	Lipoprotein	Natural	Stimulation elicits the production of tumour necrosis factor (TNF) and interleukin (IL)-6.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice (Murine)	Bone-marrow derived Dendritic cells	LRR	Q9QUN7.fasta	Q9QUN7	784	This activation can be attributed to multiple immunostimulatory components present within S. gordonii bacterial cells.	ELISA	19284500	2009	Pubchem Assay
PRRID_0407	acylated LprA Click for more detail	M. tuberculosis (Bacteria)	NA	NA	Lipoprotein	Natural	Induced IL-8 secretion	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	Phagocytosis	ELISA	20694006	2010	Pubchem Assay
PRRID_0407	acylated LprA Click for more detail	M. tuberculosis (Bacteria)	NA	NA	Lipoprotein	Natural	Induced IL-8 secretion	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	Phagocytosis	ELISA	20694006	2010	Pubchem Assay
PRRID_0408	acylated LprG Click for more detail	M. tuberculosis (Bacteria)	NA	NA	Lipoprotein	Natural	Delivery of glycolipds to TLR2	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	Phagocytosis	ELISA	20694006	2010	Pubchem Assay
PRRID_0408	acylated LprG Click for more detail	M. tuberculosis (Bacteria)	NA	NA	Lipoprotein	Natural	Delivery of glycolipds to TLR2	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	Phagocytosis	ELISA	20694006	2010	Pubchem Assay
PRRID_0458	cy2-labeled SitC-His Click for more detail	S. aureus (Bacteria)	NA	NA	Lipoprotein	Natural	It induce release of IL-6 in primary murine keratinocytes	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice (Murine)	Keratinocytes	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It induce intracellular accumulation of TLR2	NA	20679445	2010	Pubchem Assay
PRRID_0458	cy2-labeled SitC-His Click for more detail	S. aureus (Bacteria)	NA	NA	Lipoprotein	Natural	It induce release of IL-6 in primary murine keratinocytes	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice (Murine)	Keratinocytes	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It induce intracellular accumulation of TLR2	NA	20679445	2010	Pubchem Assay
PRRID_0462	Diacylated Lipopeptide Click for more detail	M. tuberculosis (Bacteria)	NA	NA	Lipoprotein	Natural	On binding to the receptor it, activates the heterocomplex of TLR2/1 and secretion of cytokines takes place	Toll-like receptor 2/6 (TLR2/6)	Toll-like receptor (TLR)	DNA samples from peripheral blood of TB patients	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	Immunostimulation and inflammation	NA	20797905	2010	NA
PRRID_0462	Diacylated Lipopeptide Click for more detail	M. tuberculosis (Bacteria)	NA	NA	Lipoprotein	Natural	On binding to the receptor it, activates the heterocomplex of TLR2/1 and secretion of cytokines takes place	Toll-like receptor 2/6 (TLR2/6)	Toll-like receptor (TLR)	DNA samples from peripheral blood of TB patients	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	Immunostimulation and inflammation	NA	20797905	2010	NA
PRRID_0525	FSL-1 Click for more detail	Mycoplasma (Bacteria)	CCCCCCCCCCCCCCCC(=O)OCC(CSC[C@@H](C(=O)NCC(=O)N[C@@H](CC(=O)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC2=CN=CN2)C(=O)N3CCC[C@H]3C(=O)N[C@@H](CCCCN)C(=ON[C@@H(COC(=O)N[C@@H](CC4=CC=CC=C4)C(=O)O)N)OC(=O)CCCCCCCCCCCCCCC	NA	Lipoprotein	Synthetic	FSL-1 binds to the heterocomplex of TLR2 and TLR6 and activates the downstream signalling	Toll-like receptor 2/6 (TLR2/6)	Toll-like receptor (TLR)	Human	Keratinocytes	Leucine-rich Repeat (LRR) Domain	Q9BXR5.fasta	Q9BXR5	811	It has the role in the inflammation.	NA	20728939	2010	Pubchem Assay
PRRID_0525	FSL-1 Click for more detail	Mycoplasma (Bacteria)	CCCCCCCCCCCCCCCC(=O)OCC(CSC[C@@H](C(=O)NCC(=O)N[C@@H](CC(=O)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC2=CN=CN2)C(=O)N3CCC[C@H]3C(=O)N[C@@H](CCCCN)C(=ON[C@@H(COC(=O)N[C@@H](CC4=CC=CC=C4)C(=O)O)N)OC(=O)CCCCCCCCCCCCCCC	NA	Lipoprotein	Synthetic	FSL-1 binds to the heterocomplex of TLR2 and TLR6 and activates the downstream signalling	Toll-like receptor 2/6 (TLR2/6)	Toll-like receptor (TLR)	Human	Keratinocytes	Leucine-rich Repeat (LRR) Domain	Q9BXR5.fasta	Q9BXR5	811	It has the role in the inflammation.	NA	20728939	2010	Pubchem Assay
PRRID_0526	FSL-1 Click for more detail	Mycoplasma salivarium (Bacteria)	CCCCCCCCCCCCCCCC(=O)OCC(CSC[C@@H](C(=O)NCC(=O)N[C@@H](CC(=O)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC2=CN=CN2)C(=O)N3CCC[C@H]3C(=O)N[C@@H](CCCCN)C(=ON[C@@H(COC(=O)N[C@@H](CC4=CC=CC=C4)C(=O)O)N)OC(=O)CCCCCCCCCCCCCCC	NA	Lipoprotein	Synthetic	Binding of the ligand leads to Akt phosphorylation and activation of the transcription factor NF-Œ∫B which results in secretion of proinflammatory cytokines	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	embryonic mouse telencephalon and NPC	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	its activation inhibits NPC proliferation and decreases cell proliferation.	NA	20456021	2010	Pubchem Assay
PRRID_0526	FSL-1 Click for more detail	Mycoplasma salivarium (Bacteria)	CCCCCCCCCCCCCCCC(=O)OCC(CSC[C@@H](C(=O)NCC(=O)N[C@@H](CC(=O)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC2=CN=CN2)C(=O)N3CCC[C@H]3C(=O)N[C@@H](CCCCN)C(=ON[C@@H(COC(=O)N[C@@H](CC4=CC=CC=C4)C(=O)O)N)OC(=O)CCCCCCCCCCCCCCC	NA	Lipoprotein	Synthetic	Binding of the ligand leads to Akt phosphorylation and activation of the transcription factor NF-Œ∫B which results in secretion of proinflammatory cytokines	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	embryonic mouse telencephalon and NPC	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	its activation inhibits NPC proliferation and decreases cell proliferation.	NA	20456021	2010	Pubchem Assay

previous12 3 4 next