Browse result page of PRRDB 2.0

PRRID	Name of Ligand	Source of ligand	Sequence of Ligand	Length of Ligand	Type of Ligand	Occurence	Role of Ligand	Name of Receptor	Type of Reeptor	Source of the Receptor	Localization	Domain	Sequence of Receptor	Swiss prot ID	Length of receptor	Function of Receptor	Assay used	PMID	Year of publication	Pubchem assay
PRRID_0005	Fucoidan Click for more detail	NA	CC1C(C(C(C(O1)C)OS(=O)(=O)O)O)O	NA	Carbohydrate	Natural	elicit innate immune response	Scavenger receptor A I (SR-A I)	Scavenger receptor (SR)	Bovine	smooth muscle cells	NA	NA	NA	NA	NA	NA	3397384	1988	NA
PRRID_0005	Fucoidan Click for more detail	NA	CC1C(C(C(C(O1)C)OS(=O)(=O)O)O)O	NA	Carbohydrate	Natural	elicit innate immune response	Scavenger receptor A I (SR-A I)	Scavenger receptor (SR)	Bovine	smooth muscle cells	NA	NA	NA	NA	NA	NA	3397384	1988	NA
PRRID_0011	D-mannose Click for more detail	Bacteria	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Carbohydrate	Natural	elicit innate immune response	Mannose receptor	Mannose receptor (MR)	Human	NA	NA	P22897.fasta	P22897	1456	Induces pro-inflammatory cytokine response	NA	1906888	1991	Pubchem Assay
PRRID_0011	D-mannose Click for more detail	Bacteria	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Carbohydrate	Natural	elicit innate immune response	Mannose receptor	Mannose receptor (MR)	Human	NA	NA	P22897.fasta	P22897	1456	Induces pro-inflammatory cytokine response	NA	1906888	1991	Pubchem Assay
PRRID_0012	Fucoidan Click for more detail	NA	CC1C(C(C(C(O1)C)OS(=O)(=O)O)O)O	NA	Carbohydrate	Natural	It Stimulates the secretion of urokinasetype plasminogen activator (uPA) in Protein Kinase-C (PKC) dependent manner.	Scavenger receptor class A	Scavenger receptor (SR)	Macrophage cell line (RAW264)	Macrophages	NA	NA	NA	NA	It leads to polyanion-induced macrophage plasminogen activation.	Functional assay for plasmin	1658006	1991	NA
PRRID_0012	Fucoidan Click for more detail	NA	CC1C(C(C(C(O1)C)OS(=O)(=O)O)O)O	NA	Carbohydrate	Natural	It Stimulates the secretion of urokinasetype plasminogen activator (uPA) in Protein Kinase-C (PKC) dependent manner.	Scavenger receptor class A	Scavenger receptor (SR)	Macrophage cell line (RAW264)	Macrophages	NA	NA	NA	NA	It leads to polyanion-induced macrophage plasminogen activation.	Functional assay for plasmin	1658006	1991	NA
PRRID_0013	L-fucose Click for more detail	Bacteria	CC(C(C(C(C=O)O)O)O)O	NA	Carbohydrate	Natural	elicit innate immune response	Mannose receptor	Mannose receptor (MR)	Human	NA	NA	P22897.fasta	P22897	1456	Induces pro-inflammatory cytokine response	NA	1906888	1991	Pubchem Assay
PRRID_0013	L-fucose Click for more detail	Bacteria	CC(C(C(C(C=O)O)O)O)O	NA	Carbohydrate	Natural	elicit innate immune response	Mannose receptor	Mannose receptor (MR)	Human	NA	NA	P22897.fasta	P22897	1456	Induces pro-inflammatory cytokine response	NA	1906888	1991	Pubchem Assay
PRRID_0014	N-acetylmannosamine Click for more detail	Bacteria	CC(=O)NC1C(C(C(OC1O)CO)O)O	NA	Carbohydrate	Natural	elicit innate immune response	Mannose receptor	Mannose receptor (MR)	Human	NA	NA	P22897.fasta	P22897	1456	Induces pro-inflammatory cytokine response	NA	1906888	1991	Pubchem Assay
PRRID_0014	N-acetylmannosamine Click for more detail	Bacteria	CC(=O)NC1C(C(C(OC1O)CO)O)O	NA	Carbohydrate	Natural	elicit innate immune response	Mannose receptor	Mannose receptor (MR)	Human	NA	NA	P22897.fasta	P22897	1456	Induces pro-inflammatory cytokine response	NA	1906888	1991	Pubchem Assay
PRRID_0016	Phorbol myristate acetate (PMA) Click for more detail	NA	CCCCCCCCCCCCCC(=O)OC1C(C2(C(C=C(CC3(C2C=C(C3=O)C)O)CO)C4C1(C4(C)C)OC(=O)C)O)C	NA	Carbohydrate	Natural	It Stimulates the secretion of urokinasetype plasminogen activator (uPA) in Protein Kinase-C (PKC) dependent manner.	Scavenger receptor class A	Scavenger receptor (SR)	Macrophage cell line (RAW264)	Macrophages	NA	NA	NA	NA	It leads to polyanion-induced macrophage plasminogen activation.	Functional assay for plasmin	1658006	1991	NA
PRRID_0016	Phorbol myristate acetate (PMA) Click for more detail	NA	CCCCCCCCCCCCCC(=O)OC1C(C2(C(C=C(CC3(C2C=C(C3=O)C)O)CO)C4C1(C4(C)C)OC(=O)C)O)C	NA	Carbohydrate	Natural	It Stimulates the secretion of urokinasetype plasminogen activator (uPA) in Protein Kinase-C (PKC) dependent manner.	Scavenger receptor class A	Scavenger receptor (SR)	Macrophage cell line (RAW264)	Macrophages	NA	NA	NA	NA	It leads to polyanion-induced macrophage plasminogen activation.	Functional assay for plasmin	1658006	1991	NA
PRRID_0038	Laminarin Click for more detail	laminaria (others)	C(C1C(C(C(C(O1)O)O)OC2C(C(C(C(O2)CO)O)OC3C(C(C(C(O3)CO)O)O)O)O)O)O	NA	Carbohydrate	Natural	Immunostimulant	Scavenger receptor C-1 (SR-C1)	Scavenger receptor (SR)	Drosophila melanogaster	NA	two complement control protein (CCP) domains and somatomedin B, MAM, and mucin-like domains	NA	NA	NA	NA	NA	7732030	1995	NA
PRRID_0038	Laminarin Click for more detail	laminaria (others)	C(C1C(C(C(C(O1)O)O)OC2C(C(C(C(O2)CO)O)OC3C(C(C(C(O3)CO)O)O)O)O)O)O	NA	Carbohydrate	Natural	Immunostimulant	Scavenger receptor C-1 (SR-C1)	Scavenger receptor (SR)	Drosophila melanogaster	NA	two complement control protein (CCP) domains and somatomedin B, MAM, and mucin-like domains	NA	NA	NA	NA	NA	7732030	1995	NA
PRRID_0079	Chondroitin Sulfates A Click for more detail	Host (Endogenous) (others)	CC(=O)NC1C(C(C(OC1O)CO)OS(=O)(=O)O)OC2C(C(C(C(O2)C(=O)O)O)O)O	NA	Carbohydrate	Natural	Chondroitin Sulfates A binds to mannose receptor via a membrane-distal cysteine-rich domain (Cys-MR).	Cys-MR	Mannose receptor (MR)	Human	Spleenocytes	carbohydrate-recognition domain (CRD)	NA	NA	NA	The Cysteine-rich Domain of the Macrophage Mannose Receptor Is a Multispecific Lectin That Recognizes Chondroitin Sulfates A and B and Sulfated Oligosaccharides of Blood Group.	NA	10748230	2000	NA
PRRID_0079	Chondroitin Sulfates A Click for more detail	Host (Endogenous) (others)	CC(=O)NC1C(C(C(OC1O)CO)OS(=O)(=O)O)OC2C(C(C(C(O2)C(=O)O)O)O)O	NA	Carbohydrate	Natural	Chondroitin Sulfates A binds to mannose receptor via a membrane-distal cysteine-rich domain (Cys-MR).	Cys-MR	Mannose receptor (MR)	Human	Spleenocytes	carbohydrate-recognition domain (CRD)	NA	NA	NA	The Cysteine-rich Domain of the Macrophage Mannose Receptor Is a Multispecific Lectin That Recognizes Chondroitin Sulfates A and B and Sulfated Oligosaccharides of Blood Group.	NA	10748230	2000	NA
PRRID_0080	Chondroitin Sulfates B Click for more detail	Host (Endogenous) (others)	NA	NA	Carbohydrate	Natural	Chondroitin Sulfates A binds to mannose receptor via a membrane-distal cysteine-rich domain (Cys-MR).	Cys-MR	Mannose receptor (MR)	Human	Spleenocytes	carbohydrate-recognition domain (CRD)	NA	NA	NA	The Cysteine-rich Domain of the Macrophage Mannose Receptor Is a Multispecific Lectin That Recognizes Chondroitin Sulfates A and B and Sulfated Oligosaccharides of Blood Group.	NA	10748230	2000	NA
PRRID_0080	Chondroitin Sulfates B Click for more detail	Host (Endogenous) (others)	NA	NA	Carbohydrate	Natural	Chondroitin Sulfates A binds to mannose receptor via a membrane-distal cysteine-rich domain (Cys-MR).	Cys-MR	Mannose receptor (MR)	Human	Spleenocytes	carbohydrate-recognition domain (CRD)	NA	NA	NA	The Cysteine-rich Domain of the Macrophage Mannose Receptor Is a Multispecific Lectin That Recognizes Chondroitin Sulfates A and B and Sulfated Oligosaccharides of Blood Group.	NA	10748230	2000	NA
PRRID_0095	Sulfated blood group chains Click for more detail	Host (Endogenous) (others)	NA	NA	Carbohydrate	Natural	Chondroitin Sulfates A binds to mannose receptor via a membrane-distal cysteine-rich domain (Cys-MR).	Cys-MR	Mannose receptor (MR)	Human	Spleenocytes	carbohydrate-recognition domain (CRD)	NA	NA	NA	The Cysteine-rich Domain of the Macrophage Mannose Receptor Is a Multispecific Lectin That Recognizes Chondroitin Sulfates A and B and Sulfated Oligosaccharides of Blood Group.	NA	10748230	2000	NA
PRRID_0095	Sulfated blood group chains Click for more detail	Host (Endogenous) (others)	NA	NA	Carbohydrate	Natural	Chondroitin Sulfates A binds to mannose receptor via a membrane-distal cysteine-rich domain (Cys-MR).	Cys-MR	Mannose receptor (MR)	Human	Spleenocytes	carbohydrate-recognition domain (CRD)	NA	NA	NA	The Cysteine-rich Domain of the Macrophage Mannose Receptor Is a Multispecific Lectin That Recognizes Chondroitin Sulfates A and B and Sulfated Oligosaccharides of Blood Group.	NA	10748230	2000	NA
PRRID_0114	alpha-methylmannoside Click for more detail	Bacteria	COC1C(C(C(C(O1)CO)O)O)O	NA	Carbohydrate	Natural	Immunostimulant	Endo180	Mannose receptor (MR)	Human	NA	lectin-like domains	Q9UBG0.fasta	Q9UBG0	1479	NA	Sugar-Binding assay	12399458	2002	Pubchem Assay
PRRID_0114	alpha-methylmannoside Click for more detail	Bacteria	COC1C(C(C(C(O1)CO)O)O)O	NA	Carbohydrate	Natural	Immunostimulant	Endo180	Mannose receptor (MR)	Human	NA	lectin-like domains	Q9UBG0.fasta	Q9UBG0	1479	NA	Sugar-Binding assay	12399458	2002	Pubchem Assay
PRRID_0117	Fucose Click for more detail	Bacteria	CC(C(C(C(C=O)O)O)O)O	NA	Carbohydrate	Natural	Immunostimulant	Endo180	Mannose receptor (MR)	Human	NA	lectin-like domains	Q9UBG0.fasta	Q9UBG0	1479	NA	Sugar-Binding assay	12399458	2002	Pubchem Assay
PRRID_0117	Fucose Click for more detail	Bacteria	CC(C(C(C(C=O)O)O)O)O	NA	Carbohydrate	Natural	Immunostimulant	Endo180	Mannose receptor (MR)	Human	NA	lectin-like domains	Q9UBG0.fasta	Q9UBG0	1479	NA	Sugar-Binding assay	12399458	2002	Pubchem Assay
PRRID_0118	glucose Click for more detail	Bacteria	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Carbohydrate	Natural	Immunostimulant	Endo180	Mannose receptor (MR)	Human	NA	lectin-like domains	Q9UBG0.fasta	Q9UBG0	1479	NA	Sugar-Binding assay	12399458	2002	Pubchem Assay
PRRID_0118	glucose Click for more detail	Bacteria	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Carbohydrate	Natural	Immunostimulant	Endo180	Mannose receptor (MR)	Human	NA	lectin-like domains	Q9UBG0.fasta	Q9UBG0	1479	NA	Sugar-Binding assay	12399458	2002	Pubchem Assay
PRRID_0131	Hyaluronic acid Click for more detail	Host (Endogenous) (others)	CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O	NA	Carbohydrate	Natural	potent activators of immunocompetent cells such as dendritic cells (DCs) and macrophages	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	Bone Marrow‚Äìderived DCs	transmembrane domain that associates with the intra- cellular adaptor protein MyD88	Q9QUK6.fasta	Q9QUK6	835	TLR 4 leads to an intracellular signaling pathway¬†NF-Œ∫B and inflammatory cytokine production which is responsible for activating the innate immune system	ELISA	11781369	2002	Pubchem Assay
PRRID_0131	Hyaluronic acid Click for more detail	Host (Endogenous) (others)	CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O	NA	Carbohydrate	Natural	potent activators of immunocompetent cells such as dendritic cells (DCs) and macrophages	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	Bone Marrow‚Äìderived DCs	transmembrane domain that associates with the intra- cellular adaptor protein MyD88	Q9QUK6.fasta	Q9QUK6	835	TLR 4 leads to an intracellular signaling pathway¬†NF-Œ∫B and inflammatory cytokine production which is responsible for activating the innate immune system	ELISA	11781369	2002	Pubchem Assay
PRRID_0138	Mannose Click for more detail	Fungi	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Carbohydrate	Natural	Immunostimulant	Endo180	Mannose receptor (MR)	Human	NA	lectin-like domains	Q9UBG0.fasta	Q9UBG0	1479	NA	Sugar-Binding assay	12399458	2002	Pubchem Assay
PRRID_0138	Mannose Click for more detail	Fungi	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Carbohydrate	Natural	Immunostimulant	Endo180	Mannose receptor (MR)	Human	NA	lectin-like domains	Q9UBG0.fasta	Q9UBG0	1479	NA	Sugar-Binding assay	12399458	2002	Pubchem Assay
PRRID_0140	N-acetylmannosamine Click for more detail	Bacteria	CC(=O)NC1C(C(C(OC1O)CO)O)O	NA	Carbohydrate	Natural	Immunostimulant	Endo180	Mannose receptor (MR)	Human	NA	lectin-like domains	Q9UBG0.fasta	Q9UBG0	1479	NA	Sugar-Binding assay	12399458	2002	Pubchem Assay
PRRID_0140	N-acetylmannosamine Click for more detail	Bacteria	CC(=O)NC1C(C(C(OC1O)CO)O)O	NA	Carbohydrate	Natural	Immunostimulant	Endo180	Mannose receptor (MR)	Human	NA	lectin-like domains	Q9UBG0.fasta	Q9UBG0	1479	NA	Sugar-Binding assay	12399458	2002	Pubchem Assay
PRRID_0141	N-acetylmannosamine Click for more detail	Bacteria	CC(=O)NC1C(C(C(OC1O)CO)O)O	NA	Carbohydrate	Natural	Immunostimulant	Endo180	Mannose receptor (MR)	Human	NA	lectin-like domains	Q9UBG0.fasta	Q9UBG0	1479	NA	Sugar-Binding assay	12399458	2002	Pubchem Assay
PRRID_0141	N-acetylmannosamine Click for more detail	Bacteria	CC(=O)NC1C(C(C(OC1O)CO)O)O	NA	Carbohydrate	Natural	Immunostimulant	Endo180	Mannose receptor (MR)	Human	NA	lectin-like domains	Q9UBG0.fasta	Q9UBG0	1479	NA	Sugar-Binding assay	12399458	2002	Pubchem Assay
PRRID_0166	GlcNAc-MurNAc dipeptide (GM-Di) Click for more detail	Gram-negative bacteria	NA	NA	Carbohydrate	Natural	elicit innate immune response	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Human	HEK293T (human embryonic kidney 293T cells)	NA	Q9HC29.fasta	Q9HC29	1040	play key roles in regulation of¬†innate immune response. NLRs can cooperate with¬†Toll-like receptors¬†and regulate inflammatory and apoptotic response.	NA	12871942	2003	Pubchem Assay
PRRID_0166	GlcNAc-MurNAc dipeptide (GM-Di) Click for more detail	Gram-negative bacteria	NA	NA	Carbohydrate	Natural	elicit innate immune response	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Human	HEK293T (human embryonic kidney 293T cells)	NA	Q9HC29.fasta	Q9HC29	1040	play key roles in regulation of¬†innate immune response. NLRs can cooperate with¬†Toll-like receptors¬†and regulate inflammatory and apoptotic response.	NA	12871942	2003	Pubchem Assay
PRRID_0167	GlcNAc-MurNAc tripeptide muropeptide (GM-TriDAP) Click for more detail	Gram-negative bacteria	NA	NA	Carbohydrate	Natural	elicit innate immune response	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Human	HEK293T (human embryonic kidney 293T cells)	NA	Q9Y239.fasta	Q9Y239	953	play key roles in regulation of¬†innate immune response. NLRs can cooperate with¬†Toll-like receptors¬†and regulate inflammatory and apoptotic response.	NA	12871942	2003	Pubchem Assay
PRRID_0167	GlcNAc-MurNAc tripeptide muropeptide (GM-TriDAP) Click for more detail	Gram-negative bacteria	NA	NA	Carbohydrate	Natural	elicit innate immune response	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Human	HEK293T (human embryonic kidney 293T cells)	NA	Q9Y239.fasta	Q9Y239	953	play key roles in regulation of¬†innate immune response. NLRs can cooperate with¬†Toll-like receptors¬†and regulate inflammatory and apoptotic response.	NA	12871942	2003	Pubchem Assay
PRRID_0174	Lewis x Click for more detail	H. pylori (Bacteria)	CC1C(C(C(C(O1)OC2C(C(OC(C2OC3C(C(C(C(O3)CO)O)O)O)CO)O)NC(=O)C)O)O)O	NA	Carbohydrate	Synthetic	It strongly binds to the DC-SIGN.	DC-SIGN	C type Lectin (CTL/CLR)	K562 cells	Dendritic cells	Lectin domain	NA	NA	NA	It induces the pathogen-driven inflammatory responses.	ELISA	12574325	2003	NA
PRRID_0174	Lewis x Click for more detail	H. pylori (Bacteria)	CC1C(C(C(C(O1)OC2C(C(OC(C2OC3C(C(C(C(O3)CO)O)O)O)CO)O)NC(=O)C)O)O)O	NA	Carbohydrate	Synthetic	It strongly binds to the DC-SIGN.	DC-SIGN	C type Lectin (CTL/CLR)	K562 cells	Dendritic cells	Lectin domain	NA	NA	NA	It induces the pathogen-driven inflammatory responses.	ELISA	12574325	2003	NA
PRRID_0175	Lewis x Click for more detail	S. mansoni (others)	CC1C(C(C(C(O1)OC2C(C(OC(C2OC3C(C(C(C(O3)CO)O)O)O)CO)O)NC(=O)C)O)O)O	NA	Carbohydrate	Synthetic	It strongly binds to the DC-SIGN.	DC-SIGN	C type Lectin (CTL/CLR)	K562 cells	Dendritic cells	Lectin domain	NA	NA	NA	It induces the pathogen-driven inflammatory responses.	ELISA	12574325	2003	NA
PRRID_0175	Lewis x Click for more detail	S. mansoni (others)	CC1C(C(C(C(O1)OC2C(C(OC(C2OC3C(C(C(C(O3)CO)O)O)O)CO)O)NC(=O)C)O)O)O	NA	Carbohydrate	Synthetic	It strongly binds to the DC-SIGN.	DC-SIGN	C type Lectin (CTL/CLR)	K562 cells	Dendritic cells	Lectin domain	NA	NA	NA	It induces the pathogen-driven inflammatory responses.	ELISA	12574325	2003	NA
PRRID_0179	Mannose capped lipoarabinomannan Click for more detail	Mycobacterium tuberculosis (Bacteria)	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Carbohydrate	Synthetic	It strongly binds to the DC-SIGN.	DC-SIGN	C type Lectin (CTL/CLR)	K562 cells	Dendritic cells	Lectin domain	NA	NA	NA	It induces the pathogen-driven inflammatory responses.	ELISA	12574325	2003	NA
PRRID_0179	Mannose capped lipoarabinomannan Click for more detail	Mycobacterium tuberculosis (Bacteria)	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Carbohydrate	Synthetic	It strongly binds to the DC-SIGN.	DC-SIGN	C type Lectin (CTL/CLR)	K562 cells	Dendritic cells	Lectin domain	NA	NA	NA	It induces the pathogen-driven inflammatory responses.	ELISA	12574325	2003	NA
PRRID_0182	PIM2 Click for more detail	Mtb H37Rv (Bacteria)	NA	NA	Carbohydrate	Natural	It stimulates the stimulate TNF-alpha, which leads to IL-12 p40 secretion.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice (Murine)	Primary Macrophages	NA	Q9QUN7.fasta	Q9QUN7	784	It leads to the inflammatory response.	ELISA	12775723	2003	Pubchem Assay
PRRID_0182	PIM2 Click for more detail	Mtb H37Rv (Bacteria)	NA	NA	Carbohydrate	Natural	It stimulates the stimulate TNF-alpha, which leads to IL-12 p40 secretion.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice (Murine)	Primary Macrophages	NA	Q9QUN7.fasta	Q9QUN7	784	It leads to the inflammatory response.	ELISA	12775723	2003	Pubchem Assay
PRRID_0183	PIM2 Click for more detail	Mtb H37Rv (Bacteria)	NA	NA	Carbohydrate	Natural	It stimulates the stimulate TNF-alpha, which leads to IL-12 p40 secretion.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice (Murine)	Primary Macrophages	NA	Q9QUN7.fasta	Q9QUN7	784	It leads to the inflammatory response.	ELISA	12775723	2003	Pubchem Assay
PRRID_0183	PIM2 Click for more detail	Mtb H37Rv (Bacteria)	NA	NA	Carbohydrate	Natural	It stimulates the stimulate TNF-alpha, which leads to IL-12 p40 secretion.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice (Murine)	Primary Macrophages	NA	Q9QUN7.fasta	Q9QUN7	784	It leads to the inflammatory response.	ELISA	12775723	2003	Pubchem Assay
PRRID_0184	PIM6 Click for more detail	Mycobacterium bovis Bacillus Calmette Guerin (Bacteria)	NA	NA	Carbohydrate	Natural	It stimulates the stimulate TNF-alpha, which leads to IL-12 p40 secretion.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice (Murine)	Primary Macrophages	NA	Q9QUN7.fasta	Q9QUN7	784	It leads to the inflammatory response.	ELISA	12775723	2003	Pubchem Assay
PRRID_0184	PIM6 Click for more detail	Mycobacterium bovis Bacillus Calmette Guerin (Bacteria)	NA	NA	Carbohydrate	Natural	It stimulates the stimulate TNF-alpha, which leads to IL-12 p40 secretion.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice (Murine)	Primary Macrophages	NA	Q9QUN7.fasta	Q9QUN7	784	It leads to the inflammatory response.	ELISA	12775723	2003	Pubchem Assay
PRRID_0185	PIM6 Click for more detail	Mtb H37Rv (Bacteria)	NA	NA	Carbohydrate	Natural	It stimulates the stimulate TNF-alpha, which leads to IL-12 p40 secretion.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice (Murine)	Primary Macrophages	NA	Q9QUN7.fasta	Q9QUN7	784	It leads to the inflammatory response.	ELISA	12775723	2003	Pubchem Assay
PRRID_0185	PIM6 Click for more detail	Mtb H37Rv (Bacteria)	NA	NA	Carbohydrate	Natural	It stimulates the stimulate TNF-alpha, which leads to IL-12 p40 secretion.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice (Murine)	Primary Macrophages	NA	Q9QUN7.fasta	Q9QUN7	784	It leads to the inflammatory response.	ELISA	12775723	2003	Pubchem Assay
PRRID_0189	(man)3-ara Click for more detail	Mycobacteria (Bacteria)	NA	NA	Carbohydrate	Natural	elicit innate immune response	DC-SIGN	C type Lectin (CTL/CLR)	THP-1 and K562	NA	NA	NA	NA	NA	It inhibits the immuno-stimulatory function of dendritic cells.	ELISA	15481146	2004	NA
PRRID_0189	(man)3-ara Click for more detail	Mycobacteria (Bacteria)	NA	NA	Carbohydrate	Natural	elicit innate immune response	DC-SIGN	C type Lectin (CTL/CLR)	THP-1 and K562	NA	NA	NA	NA	NA	It inhibits the immuno-stimulatory function of dendritic cells.	ELISA	15481146	2004	NA
PRRID_0190	(man)3-ara Click for more detail	Mycobacteria (Bacteria)	NA	NA	Carbohydrate	Natural	elicit innate immune response	DC-SIGNR	C type Lectin (CTL/CLR)	THP-1 and K562	NA	NA	NA	NA	NA	It inhibits the immuno-stimulatory function of dendritic cells.	ELISA	15481146	2004	NA
PRRID_0190	(man)3-ara Click for more detail	Mycobacteria (Bacteria)	NA	NA	Carbohydrate	Natural	elicit innate immune response	DC-SIGNR	C type Lectin (CTL/CLR)	THP-1 and K562	NA	NA	NA	NA	NA	It inhibits the immuno-stimulatory function of dendritic cells.	ELISA	15481146	2004	NA
PRRID_0191	(man)3-ara Click for more detail	Mycobacteria (Bacteria)	NA	NA	Carbohydrate	Natural	elicit innate immune response	mSIGN-R1	C type Lectin (CTL/CLR)	THP-1 and K562	NA	NA	NA	NA	NA	It inhibits the immuno-stimulatory function of dendritic cells.	ELISA	15481146	2004	NA
PRRID_0191	(man)3-ara Click for more detail	Mycobacteria (Bacteria)	NA	NA	Carbohydrate	Natural	elicit innate immune response	mSIGN-R1	C type Lectin (CTL/CLR)	THP-1 and K562	NA	NA	NA	NA	NA	It inhibits the immuno-stimulatory function of dendritic cells.	ELISA	15481146	2004	NA
PRRID_0198	glucuronoxylomannan Click for more detail	Cryptococcus neoformans(fungi)	NA	NA	Carbohydrate	Natural	It leads to the induction of tumor necrosis factor alpha, interleukin-4, IL-10, IL-12p70 and gamma interferon.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	Lung	NA	Q9QUK6.fasta	Q9QUK6	835	It leads to the inflammatory response against the fungi Cryptococcus neoformans.	ELISA	15322035	2004	Pubchem Assay
PRRID_0198	glucuronoxylomannan Click for more detail	Cryptococcus neoformans(fungi)	NA	NA	Carbohydrate	Natural	It leads to the induction of tumor necrosis factor alpha, interleukin-4, IL-10, IL-12p70 and gamma interferon.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	Lung	NA	Q9QUK6.fasta	Q9QUK6	835	It leads to the inflammatory response against the fungi Cryptococcus neoformans.	ELISA	15322035	2004	Pubchem Assay
PRRID_0199	glucuronoxylomannan Click for more detail	Cryptococcus neoformans(fungi)	NA	NA	Carbohydrate	Natural	It leads to the induction of tumor necrosis factor alpha, interleukin-4, IL-10, IL-12p70 and gamma interferon.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Lung	NA	Q9QUN7.fasta	Q9QUN7	784	It leads to the inflammatory response against the fungi Cryptococcus neoformans.	ELISA	15322035	2004	Pubchem Assay
PRRID_0199	glucuronoxylomannan Click for more detail	Cryptococcus neoformans(fungi)	NA	NA	Carbohydrate	Natural	It leads to the induction of tumor necrosis factor alpha, interleukin-4, IL-10, IL-12p70 and gamma interferon.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Lung	NA	Q9QUN7.fasta	Q9QUN7	784	It leads to the inflammatory response against the fungi Cryptococcus neoformans.	ELISA	15322035	2004	Pubchem Assay
PRRID_0218	Biglycan Click for more detail	Endogenous (others)	MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYVRSWEEPAGLQQRAGVRALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLT	238	Carbohydrate	Natural	Immunostimulant	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Macrophages	NA	O00206.fasta	O00206	839	synthesis of TNF-alpha and MIP-2.	Western blotting and ELISA.	16025156	2005	Pubchem Assay
PRRID_0218	Biglycan Click for more detail	Endogenous (others)	MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYVRSWEEPAGLQQRAGVRALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLT	238	Carbohydrate	Natural	Immunostimulant	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Macrophages	NA	O00206.fasta	O00206	839	synthesis of TNF-alpha and MIP-2.	Western blotting and ELISA.	16025156	2005	Pubchem Assay
PRRID_0264	Tripalmitoylated proteins Click for more detail	NA	NA	NA	Carbohydrate	Natural	triggers immune responses	Toll-like receptor 2 (TLR2)/Toll-like receptor (TLR1	Toll-like receptor (TLR)	Mice	Peripheral blood mononuclear cells (PBMC)	cytoplasmic leucine rich repeat (LRR)	NA	NA	NA	TLR2 is involved in the specific recognition of a wide range of ligands, either as a homodimer or as a heterodimer with TLR1 or TLR6.	ELISA	17353199	2007	NA
PRRID_0264	Tripalmitoylated proteins Click for more detail	NA	NA	NA	Carbohydrate	Natural	triggers immune responses	Toll-like receptor 2 (TLR2)/Toll-like receptor (TLR1	Toll-like receptor (TLR)	Mice	Peripheral blood mononuclear cells (PBMC)	cytoplasmic leucine rich repeat (LRR)	NA	NA	NA	TLR2 is involved in the specific recognition of a wide range of ligands, either as a homodimer or as a heterodimer with TLR1 or TLR6.	ELISA	17353199	2007	NA
PRRID_0273	Carbohydrate moieties Click for more detail	Candida albicans(fungi)	NA	NA	Carbohydrate	Natural	The stimulation of mincle by carbohydrate moities, leads to the production of TNF-‚ç∫ by macrophages.	Mincle	C type Lectin (CTL/CLR)	Mice	Macropahges	Carbohydrate binding motif (EPN)	Q9R0Q8.fasta	Q9R0Q8	214	Mincle plays a significant role in the mammalian immune response against the yeast.	ELISA	18490740	2008	Pubchem Assay
PRRID_0273	Carbohydrate moieties Click for more detail	Candida albicans(fungi)	NA	NA	Carbohydrate	Natural	The stimulation of mincle by carbohydrate moities, leads to the production of TNF-‚ç∫ by macrophages.	Mincle	C type Lectin (CTL/CLR)	Mice	Macropahges	Carbohydrate binding motif (EPN)	Q9R0Q8.fasta	Q9R0Q8	214	Mincle plays a significant role in the mammalian immune response against the yeast.	ELISA	18490740	2008	Pubchem Assay
PRRID_0292	Glucan Click for more detail	eukaryotic fungi (fungi)	C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O	NA	Carbohydrate	Natural	Glucan binds to vitellogenin with high affinity.	Vitellogenin	Phospholipoglycoprotein	Hexagrammos otakii	Macropahes	NA	NA	NA	NA	Vg is involved in anti-infectious response, functions as an opsonin that can enhance macrophage phagocytosis.	ELISA	18398466	2008	NA
PRRID_0292	Glucan Click for more detail	eukaryotic fungi (fungi)	C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O	NA	Carbohydrate	Natural	Glucan binds to vitellogenin with high affinity.	Vitellogenin	Phospholipoglycoprotein	Hexagrammos otakii	Macropahes	NA	NA	NA	NA	Vg is involved in anti-infectious response, functions as an opsonin that can enhance macrophage phagocytosis.	ELISA	18398466	2008	NA
PRRID_0300	Laminarin Click for more detail	brown algae(others)	C(C1C(C(C(C(O1)O)O)OC2C(C(C(C(O2)CO)O)OC3C(C(C(C(O3)CO)O)O)O)O)O)O	NA	Carbohydrate	Natural	Laminarin binds to vitellogenin with high affinity.	Vitellogenin	Phospholipoglycoprotein	Hexagrammos otakii	Macropahes	NA	NA	NA	NA	Vg is involved in anti-infectious response, functions as an opsonin that can enhance macrophage phagocytosis.	ELISA	18398466	2008	NA
PRRID_0300	Laminarin Click for more detail	brown algae(others)	C(C1C(C(C(C(O1)O)O)OC2C(C(C(C(O2)CO)O)OC3C(C(C(C(O3)CO)O)O)O)O)O)O	NA	Carbohydrate	Natural	Laminarin binds to vitellogenin with high affinity.	Vitellogenin	Phospholipoglycoprotein	Hexagrammos otakii	Macropahes	NA	NA	NA	NA	Vg is involved in anti-infectious response, functions as an opsonin that can enhance macrophage phagocytosis.	ELISA	18398466	2008	NA
PRRID_0333	Plant polysaccharide (EP) Click for more detail	Echinacea purpurea(plant)	NA	NA	Carbohydrate	Natural	It leads to the activation of NF-Œ∫B and stimulates the production of IL-6, TNF, IL-12 and NO.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	Peritoneal macrophages	NA	Q9QUK6.fasta	Q9QUK6	835	Echinacea polysaccharides have immunomodulatory activity.	ELISA	18618312	2008	Pubchem Assay
PRRID_0333	Plant polysaccharide (EP) Click for more detail	Echinacea purpurea(plant)	NA	NA	Carbohydrate	Natural	It leads to the activation of NF-Œ∫B and stimulates the production of IL-6, TNF, IL-12 and NO.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	Peritoneal macrophages	NA	Q9QUK6.fasta	Q9QUK6	835	Echinacea polysaccharides have immunomodulatory activity.	ELISA	18618312	2008	Pubchem Assay
PRRID_0361	Carrageenan Click for more detail	Dietary Products(others)	C1C2C(C(O1)C(C(O2)O)O)OC3C(C(C(C(O3)CO)OS(=O)(=O)[O-])OC4C(C5C(C(O4)CO5)OC6C(C(C(C(O6)CO)OS(=O)(=O)[O-])O)O)O)O	NA	Carbohydrate	Synthetic	It has the its inhibitory effects on LPS-induced TLR4-mediated NF-kappaB activation.	Deleted in malignant brain tumors 1 (DMBT1)	Pattern recognition receptor (PRR)	Mice	NA	NA	Q60997.fasta	Q60997	2085	Carrageenan inhibit DMBT1-mediated bacterial aggregation.	ELISA	19189310	2009	Pubchem Assay
PRRID_0361	Carrageenan Click for more detail	Dietary Products(others)	C1C2C(C(O1)C(C(O2)O)O)OC3C(C(C(C(O3)CO)OS(=O)(=O)[O-])OC4C(C5C(C(O4)CO5)OC6C(C(C(C(O6)CO)OS(=O)(=O)[O-])O)O)O)O	NA	Carbohydrate	Synthetic	It has the its inhibitory effects on LPS-induced TLR4-mediated NF-kappaB activation.	Deleted in malignant brain tumors 1 (DMBT1)	Pattern recognition receptor (PRR)	Mice	NA	NA	Q60997.fasta	Q60997	2085	Carrageenan inhibit DMBT1-mediated bacterial aggregation.	ELISA	19189310	2009	Pubchem Assay
PRRID_0366	Dextran Sulfate Sodium (DSS) Click for more detail	Dietary Products(others)	CC1C(C(C(C(O1)OCC2C(C(C(C(O2)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)O.Na	NA	Carbohydrate	Synthetic	It has the its inhibitory effects on LPS-induced TLR4-mediated NF-kappaB activation.	Deleted in malignant brain tumors 1 (DMBT1)	Pattern recognition receptor (PRR)	Mice	NA	NA	Q60997.fasta	Q60997	2085	DSS inhibit DMBT1-mediated bacterial aggregation.	ELISA	19189310	2009	Pubchem Assay
PRRID_0366	Dextran Sulfate Sodium (DSS) Click for more detail	Dietary Products(others)	CC1C(C(C(C(O1)OCC2C(C(C(C(O2)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)O.Na	NA	Carbohydrate	Synthetic	It has the its inhibitory effects on LPS-induced TLR4-mediated NF-kappaB activation.	Deleted in malignant brain tumors 1 (DMBT1)	Pattern recognition receptor (PRR)	Mice	NA	NA	Q60997.fasta	Q60997	2085	DSS inhibit DMBT1-mediated bacterial aggregation.	ELISA	19189310	2009	Pubchem Assay
PRRID_0401	1,3 beta glucan Click for more detail	Sparassis crispa (fungi)	C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O	NA	Carbohydrate	Natural	Anti-tumour properties	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	dendritic cells and macrophages	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	It can induce the phenotypic and functional maturation of DCs.	NA	20699131	2010	Pubchem Assay
PRRID_0401	1,3 beta glucan Click for more detail	Sparassis crispa (fungi)	C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O	NA	Carbohydrate	Natural	Anti-tumour properties	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	dendritic cells and macrophages	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	It can induce the phenotypic and functional maturation of DCs.	NA	20699131	2010	Pubchem Assay
PRRID_0431	Chitin Click for more detail	Bacteria	NA	NA	Carbohydrate	Natural	It triggered the PAMP mediated immunity	CERK1	Pattern recognition receptor (PRR)	Plants	NA	NA	A8R7E6.fasta	A8R7E6	617	It provides the immunity to the plant against the pathogen by recognizing the PAMP	NA	20713980	2010	Pubchem Assay
PRRID_0431	Chitin Click for more detail	Bacteria	NA	NA	Carbohydrate	Natural	It triggered the PAMP mediated immunity	CERK1	Pattern recognition receptor (PRR)	Plants	NA	NA	A8R7E6.fasta	A8R7E6	617	It provides the immunity to the plant against the pathogen by recognizing the PAMP	NA	20713980	2010	Pubchem Assay
PRRID_0432	Chitin Click for more detail	Bacteria	NA	NA	Carbohydrate	Natural	It induce the MAPK activation	Heterodimer of CERK1 and CEBiP	Pattern recognition receptor (PRR)	Rice	NA	NA	NA	NA	NA	It has the role in the inflammation.	NA	20713980	2010	NA
PRRID_0432	Chitin Click for more detail	Bacteria	NA	NA	Carbohydrate	Natural	It induce the MAPK activation	Heterodimer of CERK1 and CEBiP	Pattern recognition receptor (PRR)	Rice	NA	NA	NA	NA	NA	It has the role in the inflammation.	NA	20713980	2010	NA
PRRID_0433	Chitin Click for more detail	Crab shell(others)	CC(=O)NC1C(C(C(OC1O)CO)O)O	NA	Carbohydrate	Natural	It induces phosphorylation of CERK1 at multiple residues in the juxtamembrane and kinase domain	lysin motif (LysM)- containing chitin elicitor receptor kinase 1 (CERK1)	Pattern recognition receptor (PRR)	Arabidopsis	NA	NA	A8R7E6.fasta	A8R7E6	617	It provides resistance o fungal pathogens	NA	20610395	2010	Pubchem Assay
PRRID_0433	Chitin Click for more detail	Crab shell(others)	CC(=O)NC1C(C(C(OC1O)CO)O)O	NA	Carbohydrate	Natural	It induces phosphorylation of CERK1 at multiple residues in the juxtamembrane and kinase domain	lysin motif (LysM)- containing chitin elicitor receptor kinase 1 (CERK1)	Pattern recognition receptor (PRR)	Arabidopsis	NA	NA	A8R7E6.fasta	A8R7E6	617	It provides resistance o fungal pathogens	NA	20610395	2010	Pubchem Assay
PRRID_0461	Dextran Click for more detail	Bacteria	C(C1C(C(C(C(O1)OCC2C(C(C(C(O2)OCC(C(C(C(C=O)O)O)O)O)O)O)O)O)O)O)O	NA	Carbohydrate	Natural	It is the responsive PAMP for the FcLec5	FcLec5	C type Lectin (CTL/CLR)	Fenneropenaeus chinensis	hepatopancreas	CRD	NA	NA	NA	It elicit the immune response, which leads to the clearance of bacteria	ELISA	20349323	2010	NA
PRRID_0461	Dextran Click for more detail	Bacteria	C(C1C(C(C(C(O1)OCC2C(C(C(C(O2)OCC(C(C(C(C=O)O)O)O)O)O)O)O)O)O)O)O	NA	Carbohydrate	Natural	It is the responsive PAMP for the FcLec5	FcLec5	C type Lectin (CTL/CLR)	Fenneropenaeus chinensis	hepatopancreas	CRD	NA	NA	NA	It elicit the immune response, which leads to the clearance of bacteria	ELISA	20349323	2010	NA
PRRID_0569	Hyaluronan Click for more detail	Prepared by HCL degradation (others)	CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O	NA	Carbohydrate	Synthetic	Its binding leads to the production of interleukin-10, and down-regulated chemokine production.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	MRL-lpr/lpr Mice	Large intestinal epithelial cells	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	It modulates Th-1-type autoimmune disease and inflammation by up-regulating SOCS3 expression and down-regulating pleiotrophin expression via TLR-4 in intestinal epithelial cells and hence promotes the survival.	Array Analysis	20504769	2010	Pubchem Assay
PRRID_0569	Hyaluronan Click for more detail	Prepared by HCL degradation (others)	CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O	NA	Carbohydrate	Synthetic	Its binding leads to the production of interleukin-10, and down-regulated chemokine production.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	MRL-lpr/lpr Mice	Large intestinal epithelial cells	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	It modulates Th-1-type autoimmune disease and inflammation by up-regulating SOCS3 expression and down-regulating pleiotrophin expression via TLR-4 in intestinal epithelial cells and hence promotes the survival.	Array Analysis	20504769	2010	Pubchem Assay
PRRID_0674	Mannose Click for more detail	NA	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Carbohydrate	Natural	elicit innate immune response	Millectin	C type Lectin (CTL/CLR)	coral Acropora millepora	nematocysts in epidermal tissue	NA	NA	NA	NA	Millectin expression is up-regulated in response to lipopolysaccharide and peptidoglycan	immunohistochemistry	20600272	2010	NA
PRRID_0674	Mannose Click for more detail	NA	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Carbohydrate	Natural	elicit innate immune response	Millectin	C type Lectin (CTL/CLR)	coral Acropora millepora	nematocysts in epidermal tissue	NA	NA	NA	NA	Millectin expression is up-regulated in response to lipopolysaccharide and peptidoglycan	immunohistochemistry	20600272	2010	NA
PRRID_0675	Mannose Click for more detail	NA	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Carbohydrate	Natural	NA	Complement factor C3-like protein (C3-Am)	Pattern recognition receptor (PRR)	coral Acropora millepora	NA	NA	NA	NA	NA	C3-Am is expressed in response to injury, and may function as an opsonin	immunohistochemistry	20600272	2010	NA
PRRID_0675	Mannose Click for more detail	NA	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Carbohydrate	Natural	NA	Complement factor C3-like protein (C3-Am)	Pattern recognition receptor (PRR)	coral Acropora millepora	NA	NA	NA	NA	NA	C3-Am is expressed in response to injury, and may function as an opsonin	immunohistochemistry	20600272	2010	NA
PRRID_0749	Phospholipomannan Click for more detail	Candida albicans(fungi)	NA	NA	Carbohydrate	Natural	Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD88,/TIRAP and aloow the rerutiment of downstream effector	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Cell surface	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	It leadsto the secretion of the proinfalmmatory cytokines	NA	20620129	2010	Pubchem Assay
PRRID_0749	Phospholipomannan Click for more detail	Candida albicans(fungi)	NA	NA	Carbohydrate	Natural	Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD88,/TIRAP and aloow the rerutiment of downstream effector	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Cell surface	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	It leadsto the secretion of the proinfalmmatory cytokines	NA	20620129	2010	Pubchem Assay
PRRID_0774	Polyporus polysaccharide Click for more detail	NA	NA	NA	Carbohydrate	Natural	enhanced cell-surface expression of CD86 and production of both interleukin (IL)-12p40 and IL-10	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	bone derived dendritic cells	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	It involved in BMDCs maturation by inducing phenotypic and functional hanges	ELISA	20673883	2010	Pubchem Assay
PRRID_0774	Polyporus polysaccharide Click for more detail	NA	NA	NA	Carbohydrate	Natural	enhanced cell-surface expression of CD86 and production of both interleukin (IL)-12p40 and IL-10	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	bone derived dendritic cells	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	It involved in BMDCs maturation by inducing phenotypic and functional hanges	ELISA	20673883	2010	Pubchem Assay
PRRID_0779	PS-G Click for more detail	Ganoderma lucidum (fungi)	NA	NA	Carbohydrate	Natural	Binding resulted into the activation of NF-	Toll-like receptor 5 (TLR5)	Toll-like receptor (TLR)	Mice (Murine)	bone derived dendritic cells	Leucine-rich Repeat (LRR) Domain	Q9JLF7.fasta	Q9JLF7	859	promote the activation and maturation of BMDCs and macrophages	NA	20673883	2010	Pubchem Assay
PRRID_0779	PS-G Click for more detail	Ganoderma lucidum (fungi)	NA	NA	Carbohydrate	Natural	Binding resulted into the activation of NF-	Toll-like receptor 5 (TLR5)	Toll-like receptor (TLR)	Mice (Murine)	bone derived dendritic cells	Leucine-rich Repeat (LRR) Domain	Q9JLF7.fasta	Q9JLF7	859	promote the activation and maturation of BMDCs and macrophages	NA	20673883	2010	Pubchem Assay

previous12 3 4 next