ProGlyProt ID BU296 Organism Information Organism Name Vibrio sp. strain MA-138 Domain Bacteria Classification Family: Vibrionaceae Order: "Vibrionales" Class: Gammaproteobacteria Division or phylum: "Proteobacteria" Taxonomic ID (NCBI) 269094 Genome Sequence (s) GeneBank EMBL D86329 Gene Information Gene Name manA NCBI Gene ID Protein Information Protein Name β-1,4-mannanase UniProtKB/SwissProt ID O69347 NCBI RefSeq EMBL-CDS BAA25188.1 UniProtKB Sequence >tr|O69347|O69347_VIBSM Beta-1,4-mannanase OS=Vibrio sp. (strain MA-138) GN=manA PE=4 SV=1 MKFTKAIFSLLLFIWASCAHAGFYVSNGVLYEANGSAFKIRGINHAHTWYTDKLSVALSG IAATGANTVRVVLSNGYRWTKNDVSDVTNIINLAKANNLIAILEVHDTTGYGEESSAASL DSAADYWIELKNELIGQEDYVIINLGNEPFGNNNDAVAWVNDHVSAIQRLRSAGINHTIM VDAPNWGQDWKGFMLNNAQFVFNSDPKLNTIFSVHMYEVYSSYNSVNDYISSFTNNGLVL VIGEFASTHKGADVDEGSIMERSETLSLGYIGWSWSGNDTTTSDLDIVNNWDNNSYSTWG NVLINGQNGIKSTSTLATVFTCGNDCNDDSSGEYPICSSSAVDPDGDGWGWENNQSCIVQ DSSDTAPNGYPYCSQESSDPDGDGWGWENNASMCC Sequence length 395 AA Subcellular Location Extracellular Function It produces oligosaccharides of various sizes by randomly hydrolyzing the internal β-1,4-mannosidic linkages in β-mannan. It also acts on glucomannan and mannooligosaccharides. EC 3.2.1.78. Maximum activity is at pH 6.5 and 40 degree C. Glycosylation Status Glycosylation Type Information currently not available with us. Technique(s) used for Glycosylation Detection Periodic acid-Schiff (PAS) staining Literatures Reference(s) 1) Tamaru, Y., Araki, T., Amagoi, H., Mori, H. and Morishita, T. (1995) Purification and characterization of an extracellular beta-1,4-mannanase from a marine bacterium, Vibrio sp. strain MA-138. Appl Environ Microbiol, 61, 4454-4458. [PubMed: 8534110] Year of Identification 1995