ProGlyProt ID BU291 Organism Information Organism Name Treponema pallidum subsp. pallidum Nichols Domain Bacteria Classification Family: Spirochaetaceae Order: Spirochaetales Class: Spirochaetes Division or phylum: "Spirochaetes" or "Spirochaetae" Taxonomic ID (NCBI) 160 Genome Sequence (s) GeneBank AE000520.1 EMBL AE000520 Gene Information Gene Name flaB3 (TP_0870) NCBI Gene ID 2611107 Protein Information Protein Name Flagellin FlaB3 UniProtKB/SwissProt ID P21992 NCBI RefSeq NP_219305.1 EMBL-CDS AAC65835.1 UniProtKB Sequence >sp|P21992|FLAB3_TREPA Flagellar filament 31 kDa core protein OS=Treponema pallidum GN=flaB3 PE=1 SV=3 MIINHNMSAMFAQRQGGINGLAIAKNIEKLSSGYRINRAGDDASGLAVSEKMRSQIRGLN QAGQNIQNGISFIQATEGYLAETTEIVQRLRELAIQAANGIYSAEDRMQIQVEVSQLVDE VDRIASQAQFNGMNLLTGRFSRESALGPMQLHVGANMDQNEKIFINTMTASALGFFSDEG TDGSRSISIATVDGANKVIGTLDSALKEINKQRADLGAYQNRFETAYQGIAIAAENLQAA ESRIRDADLAQQMVDYTKNQILEQSTMAMLAQANTQPQAVLRLMQ Sequence length 285 AA Subcellular Location Periplasm Function Flagellar 31 kDa core protein. It is the major component of the endoflagella which are required for motility of Treponemes. Glycosylation Status Glycosylation Type Information currently not available with us. Technique(s) used for Glycosylation Detection Intrinsic [14C]glucosamine-labeling, periodate oxidation-DIG (digoxigenin) hydrazide labeling Literatures Reference(s) 1) Wyss, C. (1998) Flagellins, but not endoflagellar sheath proteins, of Treponema pallidum and of pathogen-related oral spirochetes are glycosylated. Infect Immun, 66, 5751-5754. [PubMed: 9826350] 2) Moskophidis, M. and Muller, F. (1985) Identification of glycosylated protein antigens of Treponema pallidum and Treponema phagedenis. Zentralbl Bakteriol Mikrobiol Hyg A, 259, 468-476. [PubMed: 3901616] 3) Moskophidis, M. and Muller, F. (1984) Molecular characterization of glycoprotein antigens on surface of Treponema pallidum: comparison with nonpathogenic Treponema phagedenis biotype Reiter. Infect Immun, 46, 867-869. [PubMed: 6389370] Year of Identification 1984