ProGlyProt ID BU290 Organism Information Organism Name Treponema pallidum subsp. pallidum Nichols Domain Bacteria Classification Family: Spirochaetaceae Order: Spirochaetales Class: Spirochaetes Division or phylum: "Spirochaetes" or "Spirochaetae" Taxonomic ID (NCBI) 160 Genome Sequence (s) GeneBank AE000520.1 EMBL AE000520 Gene Information Gene Name flaB2 (TP_0792) NCBI Gene ID 2610779 Protein Information Protein Name Flagellin FlaB2 UniProtKB/SwissProt ID P21991 NCBI RefSeq NP_219229.1 EMBL-CDS AAC65757.1 UniProtKB Sequence >sp|P21991|FLAB2_TREPA Flagellar filament 33 kDa core protein OS=Treponema pallidum GN=flaB2 PE=1 SV=2 MIINHNMSAMFSQRTLGHTNLSVQKNIEKLSSGLRINRSGDDASGLAVSEKMRSQIRGLN QASTNAQNGISFIQVAEAFLQETTDVIQRIRELSVQAANGIYSAEDRLYIQVEVSQLVAE VDRIASHAQFNGMNMLTGRFARQGGENTVTASMWFHIGANMDQRTRAYIGTMTAVAMGIR DAGDESVMNIDSPEKANRAIGTLDQAIKRINKQRADLGAYQNRLDHTVAGINVAAENLQA AESRIRDVDMAKEMVDYTKNQILVQSGTAMLAQANQATQSVLSLLR Sequence length 286 AA Subcellular Location Periplasm Function Flagellar 33 kDa core protein. It is the major component of the endoflagella which are required for motility of Treponemes. Glycosylation Status Glycosylation Type Information currently not available with us. Technique(s) used for Glycosylation Detection Intrinsic [14C]glucosamine-labeling, periodate oxidation-DIG (digoxigenin) hydrazide labeling Literatures Reference(s) 1) Wyss, C. (1998) Flagellins, but not endoflagellar sheath proteins, of Treponema pallidum and of pathogen-related oral spirochetes are glycosylated. Infect Immun, 66, 5751-5754. [PubMed: 9826350] 2) Moskophidis, M. and Muller, F. (1985) Identification of glycosylated protein antigens of Treponema pallidum and Treponema phagedenis. Zentralbl Bakteriol Mikrobiol Hyg A, 259, 468-476. [PubMed: 3901616] 3) Moskophidis, M. and Muller, F. (1984) Molecular characterization of glycoprotein antigens on surface of Treponema pallidum: comparison with nonpathogenic Treponema phagedenis biotype Reiter. Infect Immun, 46, 867-869. [PubMed: 6389370] Year of Identification 1984