| ProGlyProt ID | BU287 |
| Organism Information |
| Organism Name | Treponema maltophilum ATCC 51939T |
| Domain | Bacteria |
| Classification | Family: Spirochaetaceae
Order: Spirochaetales
Class: Spirochaetes
Division or phylum: "Spirochaetes" or "Spirochaetae" |
| Taxonomic ID (NCBI) | 51160 |
| Genome Sequence (s) |
| GeneBank | |
| EMBL | Y18889 |
| Gene Information |
| Gene Name | flaB2 |
| NCBI Gene ID | |
| Protein Information |
| Protein Name | Flagellar filament 31.3 kDa core protein |
| UniProtKB/SwissProt ID | Q9KWX0 |
| NCBI RefSeq | |
| EMBL-CDS | CAB67249.1 |
| UniProtKB Sequence | >sp|Q9KWX0|FLAB2_TREMA Flagellar filament 31.3 kDa core protein OS=Treponema maltophilum GN=flaB2 PE=1 SV=1
MIINHNMSAMYSNRVLGVTNLAQAKDMEKLSSGMKINRAGDDASGLAVSEKMRSQIRGLN
QASRNAQNGISFIQVSEGYLQETTDIMHRIRELAVQSSNGIYSDEDRMQIQVEVSQLVAE
VDRIASHAQFNGMNMLTGRFARATGENTVTGSMWLHIGANMDQRMQVFIGTMTAMAVGVR
EIGSEKVMSIAAPDDANRAIGTIDEGLKKINKQRADLGAYQNRLEMTVKGLDVAAENTQA
AESTIRDTDMAKQMVDFTKNRILAQAGTAMLAQANVTTQNVLTLLQ |
| Sequence length | 286 AA |
| Subcellular Location | Periplasm |
| Function | Major component of the endoflagella which are required for motility of Treponemes. |
| Glycosylation Status |
| Glycosylation Type | Information currently not available with us. |
| Technique(s) used for Glycosylation Detection | Periodate oxidation-DIG hydrazide labeling |
| Literatures |
| Reference(s) | 1) Wyss, C. (1998) Flagellins, but not endoflagellar sheath proteins, of Treponema pallidum and of pathogen-related oral spirochetes are glycosylated. Infect Immun, 66, 5751-5754. [PubMed: 9826350] |
| Year of Identification | 1998 |
