ProGlyProt ID BU287 Organism Information Organism Name Treponema maltophilum ATCC 51939T Domain Bacteria Classification Family: Spirochaetaceae Order: Spirochaetales Class: Spirochaetes Division or phylum: "Spirochaetes" or "Spirochaetae" Taxonomic ID (NCBI) 51160 Genome Sequence (s) GeneBank EMBL Y18889 Gene Information Gene Name flaB2 NCBI Gene ID Protein Information Protein Name Flagellar filament 31.3 kDa core protein UniProtKB/SwissProt ID Q9KWX0 NCBI RefSeq EMBL-CDS CAB67249.1 UniProtKB Sequence >sp|Q9KWX0|FLAB2_TREMA Flagellar filament 31.3 kDa core protein OS=Treponema maltophilum GN=flaB2 PE=1 SV=1 MIINHNMSAMYSNRVLGVTNLAQAKDMEKLSSGMKINRAGDDASGLAVSEKMRSQIRGLN QASRNAQNGISFIQVSEGYLQETTDIMHRIRELAVQSSNGIYSDEDRMQIQVEVSQLVAE VDRIASHAQFNGMNMLTGRFARATGENTVTGSMWLHIGANMDQRMQVFIGTMTAMAVGVR EIGSEKVMSIAAPDDANRAIGTIDEGLKKINKQRADLGAYQNRLEMTVKGLDVAAENTQA AESTIRDTDMAKQMVDFTKNRILAQAGTAMLAQANVTTQNVLTLLQ Sequence length 286 AA Subcellular Location Periplasm Function Major component of the endoflagella which are required for motility of Treponemes. Glycosylation Status Glycosylation Type Information currently not available with us. Technique(s) used for Glycosylation Detection Periodate oxidation-DIG hydrazide labeling Literatures Reference(s) 1) Wyss, C. (1998) Flagellins, but not endoflagellar sheath proteins, of Treponema pallidum and of pathogen-related oral spirochetes are glycosylated. Infect Immun, 66, 5751-5754. [PubMed: 9826350] Year of Identification 1998