ProGlyProt ID BU272 Organism Information Organism Name Streptomyces coelicolor J1929 Domain Bacteria Classification Family: Streptomycetaceae Suborder: Streptomycineae Order: Actinomycetales Subclass: Actinobacteridae Class: Actinobacteria Division or phylum: "Actinobacteria" Taxonomic ID (NCBI) 1902 Genome Sequence (s) GeneBank AL939119.1 EMBL AL939119 Gene Information Gene Name pstS (SCO4142) NCBI Gene ID 1099582 Protein Information Protein Name PstS (40 kDa) UniProtKB/SwissProt ID Q9KZV9 NCBI RefSeq NP_628319.1 EMBL-CDS CAB88475.1 UniProtKB Sequence >tr|Q9KZV9|Q9KZV9_STRCO Phosphate-binding protein OS=Streptomyces coelicolor GN=SCO4142 PE=4 SV=1 MNRRALALGALAVSGALALTACGSDDTGGNSGSDSSSAAANSNIKCDDAKGQLQASGSSA QKNAIDAWVKQYVAACNGVQINYNPTGSGAGITAFTQGQTAFAGSDSALKPDEIEASKKV CKDGQAIDLPMVGGPIAVGFNVTGVDSLVLDAPTMAKIFDSKITNWNDEAIKKLNPDAKL PDLKIQAFHRSDESGTTDNFTKYLKAAAPDDWKYEGGKSWEAKGGQSAQGSSGLAGQVKQ TPGAISYFELSYAKDGIKTVDVKTAAAEPVKATVENATAAIGAAKVVGTGKDLALELDYT PDAAGAYPLVLVTYEIACDKGNKADTLPATKSFLNYMASEDGQGLLADAGYAPMPTEIIT KVRETISGLS Sequence length 370 AA Subcellular Location Secreted Function Phosphate binding protein involved in high affinity phosphate uptake. Glycosylation Status Glycosylation Type Information currently not available with us. Technique(s) used for Glycosylation Detection Pro-Q Emerald Glycoprotein staining (that uses periodate oxidation) and ConA–sepharose affinity chromatography. Literatures Reference(s) 1) Wehmeier, S., Varghese, A.S., Gurcha, S.S., Tissot, B., Panico, M., Hitchen, P., Morris, H.R., Besra, G.S., Dell, A. and Smith, M.C. (2009) Glycosylation of the phosphate binding protein, PstS, in Streptomyces coelicolor by a pathway that resembles protein O-mannosylation in eukaryotes. Mol Microbiol, 71, 421-433. [PubMed: 19017269] Year of Identification 2009