ProGlyProt ID BU267 Organism Information Organism Name Streptococcus pyogenes type M5 (Manfredo strain) Domain Bacteria Classification Family: Streptococcaceae Order: Lactobacillales Class: Bacilli (or Firmibacteria) Division or phylum: "Firmicutes" Taxonomic ID (NCBI) 160491 Genome Sequence (s) GeneBank AM295007.1 EMBL AM295007 Gene Information Gene Name sagP or arcA (SpyM50577) NCBI Gene ID 4964002 Protein Information Protein Name Streptococcal acid glycoprotein SAGP UniProtKB/SwissProt ID P58827 NCBI RefSeq YP_001128150.1 EMBL-CDS CAM29914.1 UniProtKB Sequence >sp|P58827|ARCA_STRPG Arginine deiminase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=arcA PE=1 SV=3 MTAQTPIHVYSEIGKLKKVLLHRPGKEIENLMPDYLERLLFDDIPFLEDAQKEHDAFAQA LRDEGIEVLYLETLAAESLVTPEIREAFIDEYLSEANIRGRATKKAIRELLMAIEDNQEL IEKTMAGVQKSELPEIPASEKGLTDLVESNYPFAIDPMPNLYFTRDPFATIGTGVSLNHM FSETRNRETLYGKYIFTHHPIYGGGKVPMVYDRNETTRIEGGDELVLSKDVLAVGISQRT DAASIEKLLVNIFKQNLGFKKVLAFEFANNRKFMHLDTVFTMVDYDKFTIHPEIEGDLRV YSVTYDNEELHIIEEKGDLAELLAANLGVEKVDLIRCGGDNLVAAGREQWNDGSNTLTIA PGVVVVYNRNTITNAILESKGLKLIKIHGSELVRGRGGPRCMSMPFEREDI Sequence length 411 AA Subcellular Location Intracellular Function SAGP,or its homolog,possesses AD (L-arginine deiminase) activity. The potent inhibition of proliferation of human T-cells by streptococcal CE is due to activity of this enzyme. Glycosylation Status Glycosylation Type Technique(s) used for Glycosylation Detection Literatures Reference(s) 1) Degnan, B.A., Fontaine, M.C., Doebereiner, A.H., Lee, J.J., Mastroeni, P., Dougan, G., Goodacre, J.A. and Kehoe, M.A. (2000) Characterization of an isogenic mutant of Streptococcus pyogenes Manfredo lacking the ability to make streptococcal acid glycoprotein. Infect Immun, 68, 2441-2448. [PubMed: 10768929] 2) Degnan, B.A., Palmer, J.M., Robson, T., Jones, C.E., Fischer, M., Glanville, M., Mellor, G.D., Diamond, A.G., Kehoe, M.A. and Goodacre, J.A. (1998) Inhibition of human peripheral blood mononuclear cell proliferation by Streptococcus pyogenes cell extract is associated with arginine deiminase activity. Infect Immun, 66, 3050-3058. [PubMed: 9632565] Year of Identification 2000