ProGlyProt ID BU266 Organism Information Organism Name Streptococcus pyogenes strain Su Domain Bacteria Classification Family: Streptococcaceae Order: Lactobacillales Class: Bacilli (or Firmibacteria) Division or phylum: "Firmicutes" Taxonomic ID (NCBI) 1314 Genome Sequence (s) GeneBank EMBL X55659 Gene Information Gene Name arcA or sagP NCBI Gene ID Protein Information Protein Name Streptococcal acid glycoprotein SAGP UniProtKB/SwissProt ID P0C0B3 NCBI RefSeq EMBL-CDS CAA39192.1 UniProtKB Sequence >sp|P0C0B3|ARCA_STRPY Arginine deiminase OS=Streptococcus pyogenes GN=arcA PE=1 SV=2 MTAQTPIHVYSEIGKLKKVLLHRPGKEIENLMPDYLERLLFDDIPFLEDAQKEHDAFAQA LRDEGIEVLYLETLAAESLVTPEIREAFIDEYLSEANIRGRATKKAIRELLMAIEDNQEL IEKTMAGVQKSELPEIPASEKGLTDLVESNYPFAIDPMPNLYFTRDPFATIGTGVSLNHM FSETRNRETLYGKYIFTHHPIYGGGKVPMVYDRNETTRIEGGDELVLSKDVLAVGISQRT DAASIEKLLVNIFKQNLGFKKVLAFEFANNRKFMHLDTVFTMVDYDKFTIHPEIEGDLRV YSVTYDNEELHIVEEKGDLAELLAANLGVEKVDLIRCGGDNLVAAGREQWNDGSNTLTIA PGVVVVYNRNTITNAILESKGLKLIKIHGSELVRGRGGPRCMSMPFEREDI Sequence length 411 AA Subcellular Location Intracellular Function Antitumour protein. Glycosylation Status Glycosylation Type Technique(s) used for Glycosylation Detection Literatures Reference(s) 1) Degnan, B.A., Fontaine, M.C., Doebereiner, A.H., Lee, J.J., Mastroeni, P., Dougan, G., Goodacre, J.A. and Kehoe, M.A. (2000) Characterization of an isogenic mutant of Streptococcus pyogenes Manfredo lacking the ability to make streptococcal acid glycoprotein. Infect Immun, 68, 2441-2448. [PubMed: 10768929] 2) Degnan, B.A., Palmer, J.M., Robson, T., Jones, C.E., Fischer, M., Glanville, M., Mellor, G.D., Diamond, A.G., Kehoe, M.A. and Goodacre, J.A. (1998) Inhibition of human peripheral blood mononuclear cell proliferation by Streptococcus pyogenes cell extract is associated with arginine deiminase activity. Infect Immun, 66, 3050-3058. [PubMed: 9632565] 3) Kanaoka, M., Negoro, T., Kawanaka, C., Agui, H. and Nabeshima, S. (1991) Streptococcal antitumor protein: expression in Escherichia coli cells and properties of the recombinant protein. Agric Biol Chem, 55, 743-750. [PubMed: 1368629] 4) Kanaoka, M., Fukita, Y., Taya, K., Kawanaka, C., Negoro, T. and Agui, H. (1987) A Year of Identification 1985