| ProGlyProt ID | BU260 |
| Organism Information |
| Organism Name | Serpulina (Treponema) hyodysenteriae |
| Domain | Bacteria |
| Classification | Family: "Brachyspiraceae"
Order: Spirochaetales
Class: Spirochaetes
Division or phylum: "Spirochaetes" or "Spirochaetae" |
| Taxonomic ID (NCBI) | 159 |
| Genome Sequence (s) |
| GeneBank | |
| EMBL | X63006 |
| Gene Information |
| Gene Name | flaA1 |
| NCBI Gene ID | |
| Protein Information |
| Protein Name | PF sheath protein (44 kDa) |
| UniProtKB/SwissProt ID | P32520 |
| NCBI RefSeq | |
| EMBL-CDS | CAA44735.1 |
| UniProtKB Sequence | >sp|P32520|FLAA1_TREHY Flagellar filament outer layer protein flaA1 OS=Treponema hyodysenteriae GN=flaA1 PE=1 SV=1
MKKLFVVLTSIFIAASAYGLTNSTLIDFALTGNADNLQAGEGDTNEVVPVAENLYNDNWV
VWLNESARLTENRRNSYVTNVDSKGNNGAWEAGKVLGVRVHFPLAAWNSYALVKPVYELE
MYGGADGTKYTEGKGVIHNVGEIKSISSWVYGRNYLISYFVNLQNEFGELKSYPMGTVYF
NGWRQVRWENREYLPNVRDRVLVREPLYPRMIPSVKLDSLGFYRTKDTKGGDFITYVKDV
TLEYDVVVVDFEEDIDDEATWQLLKTENDRKQAIESARIREQAELRDLEQRRIGDGTAAD
QGAAANTGAADTGAAQEQAQ |
| Sequence length | 320 AA |
| Subcellular Location | Periplasm (Outer membrane) |
| Function | Periplasmic flagellar sheath protein is a species-specific glycoprotein antigen. May be an important target for the host immune response. |
| Glycosylation Status |
| Glycosylation Type | Information currently not available with us. |
| Technique(s) used for Glycosylation Detection | Glycoprotein staining (DIG glycan detection kit), deglycosylation with N-glycosidase F. |
| Literatures |
| Reference(s) | 1) Li, Z., Dumas, F., Dubreuil, D. and Jacques, M. (1993) A species-specific periplasmic flagellar protein of Serpulina (Treponema) hyodysenteriae. J Bacteriol, 175, 8000-8007. [PubMed: 8253687] |
| Year of Identification | 1993 |
