ProGlyProt ID BU260 Organism Information Organism Name Serpulina (Treponema) hyodysenteriae Domain Bacteria Classification Family: "Brachyspiraceae" Order: Spirochaetales Class: Spirochaetes Division or phylum: "Spirochaetes" or "Spirochaetae" Taxonomic ID (NCBI) 159 Genome Sequence (s) GeneBank EMBL X63006 Gene Information Gene Name flaA1 NCBI Gene ID Protein Information Protein Name PF sheath protein (44 kDa) UniProtKB/SwissProt ID P32520 NCBI RefSeq EMBL-CDS CAA44735.1 UniProtKB Sequence >sp|P32520|FLAA1_TREHY Flagellar filament outer layer protein flaA1 OS=Treponema hyodysenteriae GN=flaA1 PE=1 SV=1 MKKLFVVLTSIFIAASAYGLTNSTLIDFALTGNADNLQAGEGDTNEVVPVAENLYNDNWV VWLNESARLTENRRNSYVTNVDSKGNNGAWEAGKVLGVRVHFPLAAWNSYALVKPVYELE MYGGADGTKYTEGKGVIHNVGEIKSISSWVYGRNYLISYFVNLQNEFGELKSYPMGTVYF NGWRQVRWENREYLPNVRDRVLVREPLYPRMIPSVKLDSLGFYRTKDTKGGDFITYVKDV TLEYDVVVVDFEEDIDDEATWQLLKTENDRKQAIESARIREQAELRDLEQRRIGDGTAAD QGAAANTGAADTGAAQEQAQ Sequence length 320 AA Subcellular Location Periplasm (Outer membrane) Function Periplasmic flagellar sheath protein is a species-specific glycoprotein antigen. May be an important target for the host immune response. Glycosylation Status Glycosylation Type Information currently not available with us. Technique(s) used for Glycosylation Detection Glycoprotein staining (DIG glycan detection kit), deglycosylation with N-glycosidase F. Literatures Reference(s) 1) Li, Z., Dumas, F., Dubreuil, D. and Jacques, M. (1993) A species-specific periplasmic flagellar protein of Serpulina (Treponema) hyodysenteriae. J Bacteriol, 175, 8000-8007. [PubMed: 8253687] Year of Identification 1993