| ProGlyProt ID | BU259 |
| Organism Information |
| Organism Name | Salmonella enterica serovar Typhimurium |
| Domain | Bacteria |
| Classification | Family: Enterobacteriaceae
Order: "Enterobacteriales"
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria" |
| Taxonomic ID (NCBI) | 90371 |
| Genome Sequence (s) |
| GeneBank | AE006468.1 |
| EMBL | AE006468 |
| Gene Information |
| Gene Name | dps (STM0831) |
| NCBI Gene ID | 1252350 |
| Protein Information |
| Protein Name | Dps (18 kDa), Stress inducible DNA binding protein |
| UniProtKB/SwissProt ID | Q7CQV9 |
| NCBI RefSeq | NP_459808.1 |
| EMBL-CDS | AAL19767.1 |
| UniProtKB Sequence | >sp|Q7CQV9|DPS_SALTY DNA protection during starvation protein OS=Salmonella typhimurium GN=dps PE=3 SV=3
MSTAKLVKTKASNLLYTRNDVSESDKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFI
AVHEMLDGFRTALTDHLDTMAERAVQLGGVALGTTQVINSKTPLKSYPLDIHNVQDHLKE
LADRYAVVANDVRKAIGEAKDEDTADIFTAASRDLDKFLWFIESNIE
|
| Sequence length | 167 AA |
| Subcellular Location | Intracellular |
| Function | Dps is a protein that is produced in large amounts when the bacterial cell faces harm (starvation), which results in DNA protection (DNA biocrystallization). Glycosylated Dps is produced in the pre- and early stationary phases of bacterial growth. |
| Glycosylation Status |
| Glycosylation Type | Information currently not available with us. |
| Technique(s) used for Glycosylation Detection | PAS-staining and enzyme-linked lectin assay (jacalin, conA, KM+) |
| Literatures |
| Reference(s) | 1) Hanna, E.S., Roque-Barreira, M.C., Bernardes, E.S., Panunto-Castelo, A., Sousa, M.V., Almeida, I.C. and Brocchi, M. (2007) Evidence for glycosylation on a DNA-binding protein of Salmonella enterica. Microb Cell Fact, 6, 11. [PubMed: 17407574] |
| Year of Identification | 2007 |
