ProGlyProt ID BU259 Organism Information Organism Name Salmonella enterica serovar Typhimurium Domain Bacteria Classification Family: Enterobacteriaceae Order: "Enterobacteriales" Class: Gammaproteobacteria Division or phylum: "Proteobacteria" Taxonomic ID (NCBI) 90371 Genome Sequence (s) GeneBank AE006468.1 EMBL AE006468 Gene Information Gene Name dps (STM0831) NCBI Gene ID 1252350 Protein Information Protein Name Dps (18 kDa), Stress inducible DNA binding protein UniProtKB/SwissProt ID Q7CQV9 NCBI RefSeq NP_459808.1 EMBL-CDS AAL19767.1 UniProtKB Sequence >sp|Q7CQV9|DPS_SALTY DNA protection during starvation protein OS=Salmonella typhimurium GN=dps PE=3 SV=3 MSTAKLVKTKASNLLYTRNDVSESDKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFI AVHEMLDGFRTALTDHLDTMAERAVQLGGVALGTTQVINSKTPLKSYPLDIHNVQDHLKE LADRYAVVANDVRKAIGEAKDEDTADIFTAASRDLDKFLWFIESNIE Sequence length 167 AA Subcellular Location Intracellular Function Dps is a protein that is produced in large amounts when the bacterial cell faces harm (starvation), which results in DNA protection (DNA biocrystallization). Glycosylated Dps is produced in the pre- and early stationary phases of bacterial growth. Glycosylation Status Glycosylation Type Information currently not available with us. Technique(s) used for Glycosylation Detection PAS-staining and enzyme-linked lectin assay (jacalin, conA, KM+) Literatures Reference(s) 1) Hanna, E.S., Roque-Barreira, M.C., Bernardes, E.S., Panunto-Castelo, A., Sousa, M.V., Almeida, I.C. and Brocchi, M. (2007) Evidence for glycosylation on a DNA-binding protein of Salmonella enterica. Microb Cell Fact, 6, 11. [PubMed: 17407574] Year of Identification 2007