ProGlyProt ID BU256 Organism Information Organism Name Pseudomonas syringae pv. tomato str. DC3000 Domain Bacteria Classification Family: Pseudomonadaceae Order: Pseudomonadales Class: Gammaproteobacteria Division or phylum: "Proteobacteria" Taxonomic ID (NCBI) 223283 Genome Sequence (s) GeneBank AE016853.1 EMBL AE016853 Gene Information Gene Name fliC (PSPTO1949) NCBI Gene ID 1183594 Protein Information Protein Name Flagellin UniProtKB/SwissProt ID Q884Y7 NCBI RefSeq NP_791772.1 EMBL-CDS AAO55467.1 UniProtKB Sequence >tr|Q884Y7|Q884Y7_PSESM Flagellin OS=Pseudomonas syringae pv. tomato str. DC3000 GN=fliC PE=4 SV=1 MALTVNTNVASLNVQKNLGRASDALSTSMTRLSSGLKINSAKDDAAGLQIATKITSQIRG QTMAIKNANDGMSLAQTAEGALQESTNILQRMRELAVQSRNDSNSATDREALNKEFTAMS SELTRIAQSTNLNGKNLLDGSASTMTFQVGSNSGASNQISLTLSASFDANTLGVGSAISI TGADSATSEAAFSAAVAAIDSALQTINSTRADLGAAQNRLTSTISNLQNINENASAALGR VQDTDFAAETAQLTKQQTLQQASTSVLAQANQLPSAVLKLLQ Sequence length 282 AA Subcellular Location Flagellum Function Structural subunit of flagellum. It plays a role in the induction of hypersensitive cell death in its non-host tobacco plants. Glycosylation Status Glycosylation Type Information currently not available with us. Technique(s) used for Glycosylation Detection Chemical deglycosylation with anhydrous trifluoromethanesulfonic acid (TFMS) and glycoprotein staining (using GelCode kit) Literatures Reference(s) 1) Taguchi, F., Shimizu, R., Inagaki, Y., Toyoda, K., Shiraishi, T. and Ichinose, Y. (2003) Post-translational modification of flagellin determines the specificity of HR induction. Plant Cell Physiol, 44, 342-349. [PubMed: 12668781] Year of Identification 2003