ProGlyProt ID BU241 Organism Information Organism Name Paenibacillus (Bacillus) macerans Domain Bacteria Classification Family: Bacillaceae Order: Bacillales Class: Bacilli (or Firmibacteria) Division or phylum: "Firmicutes" Taxonomic ID (NCBI) 44252 Genome Sequence (s) GeneBank EMBL X55959 Gene Information Gene Name NCBI Gene ID Protein Information Protein Name (1,3-1,4)-beta-glucanase (MAC) UniProtKB/SwissProt ID P23904 NCBI RefSeq EMBL-CDS CAA39426.1 UniProtKB Sequence >sp|P23904|GUB_PAEMA Beta-glucanase OS=Paenibacillus macerans PE=1 SV=2 MKKKSCFTLVTTFAFSLIFSVSALAGSVFWEPLSYFNRSTWEKADGYSNGGVFNCTWRAN NVNFTNDGKLKLGLTSSAYNKFDCAEYRSTNIYGYGLYEVSMKPAKNTGIVSSFFTYTGP AHGTQWDEIDIEFLGKDTTKVQFNYYTNGVGGHEKVISLGFDASKGFHTYAFDWQPGYIK WYVDGVLKHTATANIPSTPGKIMMNLWNGTGVDDWLGSYNGANPLYAEYDWVKYTSN Sequence length 237 AA Subcellular Location Secreted Function Catalyses cleavage of (1,4)-beta-linkages of O-substituted beta-D-glucanopyranosyl residues. Glycosylation Status Glycosylation Type N(Asn)- linked Technique(s) used for Glycosylation Detection Literatures Reference(s) 1) Meldgaard, M. and Svendsen, I. (1994) Different effects of N-glycosylation on the thermostability of highly homologous bacterial (1,3-1,4)-beta-glucanases secreted from yeast. Microbiology, 140 ( Pt 1), 159-166. [PubMed: 8162185] 2) Olsen, O., Thomesen, K. K. (1991) Improvement of bacterial P-glucanase thermostability by glycosylation. J Gen Microbiol, 137, 579–585. Year of Identification 1991