Search ProCGP (Characterized Glycoproteins) Search ProUGP (Uncharacterized Glycoproteins) Example Display Page Crystal Structures Homology Models Map Sequon Glyseq Extractor Blast Recent Reviews Related Tools & Databases Bibliography ProGlycProt ProGlyProt ID BU240 Organism Information Organism Name Paenibacillus (Bacillus) amyloliquefaciens (veleze Domain Bacteria Classification Family: Bacillaceae Order: Bacillales Class: Bacilli (or Firmibacteria) Division or phylum: "Firmicutes" Taxonomic ID (NCBI) 1390 Genome Sequence (s) GeneBank EMBL M15674 Gene Information Gene Name bglA NCBI Gene ID Protein Information Protein Name H(A107-M) (1,3-1,4)-beta-glucanase UniProtKB/SwissProt ID P07980 NCBI RefSeq EMBL-CDS AAA87323.1 UniProtKB Sequence >sp|P07980|GUB_BACAM Beta-glucanase OS=Bacillus amyloliquefaciens GN=bglA PE=3 SV=1 MKRVLLILVTGLFMSLCGITSSVSAQTGGSFFEPFNSYNSGLWQKADGYSNGDMFNCTWR ANNVSMTSLGEMRLALTSPSYNKFDCGENRSVQTYGYGLYEVRMKPAKNTGIVSSFFTYT GPTEGTPWDEIDIEFLGKDTTKVQFNYYTNGAGNHEKFADLGFDAANAYHTYAFDWQPNS IKWYVDGQLKHTATTQIPAAPGKIMMNLWNGTGVDDWLGSYNGVNPIYAHYDWMRYRKK Sequence length 239 AA Subcellular Location Secreted Function Catalyses cleavage of (1,4)-beta-linkages of O-substituted beta-D-glucanopyranosyl residues. Glycosylation Status Glycosylation Type Technique(s) used for Glycosylation Detection Carbohydrate content determination with GLC Literatures Reference(s) 1) Meldgaard, M. and Svendsen, I. (1994) Different effects of N-glycosylation on the thermostability of highly homologous bacterial (1,3-1,4)-beta-glucanases secreted from yeast. Microbiology, 140 ( Pt 1), 159-166. [PubMed: 8162185] 2) Olsen, O., Thomesen, K. K. (1991) Improvement of bacterial P-glucanase thermostability by glycosylation. J Gen Microbiol, 137, 579–585. Year of Identification 1991