ProGlyProt ID BU226 Organism Information Organism Name Mycobacterium tuberculosis Domain Bacteria Classification Family: Mycobacteriaceae Suborder: Corynebacterineae Order: Actinomycetales Subclass: Actinobacteridae Class: Actinobacteria Division or phylum: "Actinobacteria" Taxonomic ID (NCBI) 1773 Genome Sequence (s) GeneBank BX842576.1 EMBL BX842576 Gene Information Gene Name Rv1324 NCBI Gene ID 886897 Protein Information Protein Name Thioredoxin UniProtKB/SwissProt ID P64807 NCBI RefSeq NP_215840.1 EMBL-CDS CAA98088.1 UniProtKB Sequence >sp|P64807|Y1324_MYCTU Uncharacterized protein Rv1324/MT1366 OS=Mycobacterium tuberculosis GN=Rv1324 PE=4 SV=1 MTRPRPPLGPAMAGAVDLSGIKQRAQQNAAASTDADRALSTPSGVTEITEANFEDEVIVR SDEVPVVVLLWSPRSEVCVDLLDTLSGLAAAAKGKWSLASVNVDVAPRVAQIFGVQAVPT VVALAAGQPISSFQGLQPADQLSRWVDSLLSATAGKLKGAASSEESTEVDPAVAQARQQL EDGDFVAARKSYQAILDANPGSVEAKAAIRQIEFLIRATAQRPDAVSVADSLSDDIDAAF AAADVQVLNQDVSAAFERLIALVRRTSGEERTRVRTRLIELFELFDPADPEVVAGRRNLA NALY Sequence length 304 AA Subcellular Location Function Thioredoxin Glycosylation Status Glycosylation Type Information currently not available with us. Technique(s) used for Glycosylation Detection Concanavalin A (ConA) binding Literatures Reference(s) 1) Gonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C. (2009) Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins. J Proteome Res, 8, 721-733. [PubMed: 19196185] Year of Identification 2009