ProGlyProt ID BU220 Organism Information Organism Name Mycobacterium tuberculosis Domain Bacteria Classification Family: Mycobacteriaceae Suborder: Corynebacterineae Order: Actinomycetales Subclass: Actinobacteridae Class: Actinobacteria Division or phylum: "Actinobacteria" Taxonomic ID (NCBI) 1773 Genome Sequence (s) GeneBank BX842575.1 EMBL BX842575 Gene Information Gene Name Rv0988 NCBI Gene ID 885353 Protein Information Protein Name Rv0988 UniProtKB/SwissProt ID O86370 NCBI RefSeq NP_215503.1 EMBL-CDS CAA17587.1 UniProtKB Sequence >tr|O86370|O86370_MYCTU POSSIBLE CONSERVED EXPORTED PROTEIN OS=Mycobacterium tuberculosis GN=MT1017 PE=4 SV=1 MRKAGLTGVVLVLTLTLVAFWWWQRPRTNAVAADSLVGVLVDENNAGYSLATVPGAVRFP RDLGPHYDYQTEWWYYTGNLETADGRLFGYQLTFFRRALAPPGEGVAIADASSWRTTQVY MAHFAISDISNRGFYPAEKFSRQALGLAGASSEPYAVWLDDWYARESNNNSVQLFARTQN TVLDLTLTQTLPPILQGNAGLSVKGAQPGNASNYYSLVRQESRGTVSVNGDTFMVSGLSW KDHEYMTSALAPEDVGWDWFGLQFYNGTALMLFQIRQADGSVTRFSSGTFVAGDGGVIPL ESSDFRIKTTDRWTSDQSGATYPIAWEIEIERIGLTLRGAALMANQELRLSRTYWEGAVA LEGRYQGMPISGRGYVEMTGYVQRLS Sequence length 386 AA Subcellular Location Function Glycosylation Status Glycosylation Type Information currently not available with us. Technique(s) used for Glycosylation Detection Concanavalin A (ConA) binding Literatures Reference(s) 1) Gonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C. (2009) Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins. J Proteome Res, 8, 721-733. [PubMed: 19196185] Year of Identification 2009