ProGlyProt ID BU216 Organism Information Organism Name Mycobacterium tuberculosis Domain Bacteria Classification Family: Mycobacteriaceae Suborder: Corynebacterineae Order: Actinomycetales Subclass: Actinobacteridae Class: Actinobacteria Division or phylum: "Actinobacteria" Taxonomic ID (NCBI) 1773 Genome Sequence (s) GeneBank BX842575.1 EMBL BX842575 Gene Information Gene Name pstS3 (Rv0928) NCBI Gene ID 885366 Protein Information Protein Name PstS3 UniProtKB/SwissProt ID P0A5Y2 NCBI RefSeq YP_177768.1 EMBL-CDS CAE55337.1 UniProtKB Sequence >sp|P0A5Y2|PSTS3_MYCTU Phosphate-binding protein pstS 3 OS=Mycobacterium tuberculosis GN=pstS3 PE=1 SV=1 MKLNRFGAAVGVLAAGALVLSACGNDDNVTGGGATTGQASAKVDCGGKKTLKASGSTAQA NAMTRFVNVFEQACPGQTLNYTANGSGAGISEFNGNQTDFGGSDVPLSKDEAAAAQRRCG SPAWNLPVVFGPIAVTYNLNSVSSLNLDGPTLAKIFNGSITQWNNPAIQALNRDFTLPGE RIHVVFRSDESGTTDNFQRYLQAASNGAWGKGAGKSFQGGVGEGARGNDGTSAAAKNTPG SITYNEWSFAQAQHLTMANIVTSAGGDPVAITIDSVGQTIAGATISGVGNDLVLDTDSFY RPKRPGSYPIVLATYEIVCSKYPDSQVGTAVKAFLQSTIGAGQSGLGDNGYIPIPDEFKS RLSTAVNAIA Sequence length 370 AA Subcellular Location Cell membrane Function Phosphate-binding lipoprotein PSTS3 (PBP-3) (PSTS3) (PHOS1); Part of the ABC transporter complex pstSACB involved in phosphate import. It is induced by phosphate starvation. Glycosylation Status Glycosylation Type Information currently not available with us. Technique(s) used for Glycosylation Detection Concanavalin A (ConA) binding Literatures Reference(s) 1) Gonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C. (2009) Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins. J Proteome Res, 8, 721-733. [PubMed: 19196185] Year of Identification 2009