ProGlyProt ID BU215 Organism Information Organism Name Mycobacterium tuberculosis Domain Bacteria Classification Family: Mycobacteriaceae Suborder: Corynebacterineae Order: Actinomycetales Subclass: Actinobacteridae Class: Actinobacteria Division or phylum: "Actinobacteria" Taxonomic ID (NCBI) 1773 Genome Sequence (s) GeneBank BX842575.1 EMBL BX842575 Gene Information Gene Name pstS2 (Rv0932c) NCBI Gene ID 885613 Protein Information Protein Name PstS2 UniProtKB/SwissProt ID O05870 NCBI RefSeq YP_177769.1 EMBL-CDS CAE55338.1 UniProtKB Sequence >sp|O05870|PSTS2_MYCTU Phosphate-binding protein pstS 2 OS=Mycobacterium tuberculosis GN=pstS2 PE=1 SV=1 MKFARSGAAVSLLAAGTLVLTACGGGTNSSSSGAGGTSGSVHCGGKKELHSSGSTAQENA MEQFVYAYVRSCPGYTLDYNANGSGAGVTQFLNNETDFAGSDVPLNPSTGQPDRSAERCG SPAWDLPTVFGPIAITYNIKGVSTLNLDGPTTAKIFNGTITVWNDPQIQALNSGTDLPPT PISVIFRSDKSGTSDNFQKYLDGASNGAWGKGASETFNGGVGVGASGNNGTSALLQTTDG SITYNEWSFAVGKQLNMAQIITSAGPDPVAITTESVGKTIAGAKIMGQGNDLVLDTSSFY RPTQPGSYPIVLATYEIVCSKYPDATTGTAVRAFMQAAIGPGQEGLDQYGSIPLPKSFQA KLAAAVNAIS Sequence length 370 AA Subcellular Location Cell membrane Function Phosphate-binding lipoprotein PSTS2 (PBP-2) (PSTS2) . Part of the ABC transporter complex pstSACB involved in phosphate import. It is induced by phosphate starvation. Glycosylation Status Glycosylation Type Information currently not available with us. Technique(s) used for Glycosylation Detection Concanavalin A (ConA) binding Literatures Reference(s) 1) Gonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C. (2009) Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins. J Proteome Res, 8, 721-733. [PubMed: 19196185] Year of Identification 2009