ProGlyProt ID BU213 Organism Information Organism Name Mycobacterium tuberculosis Domain Bacteria Classification Family: Mycobacteriaceae Suborder: Corynebacterineae Order: Actinomycetales Subclass: Actinobacteridae Class: Actinobacteria Division or phylum: "Actinobacteria" Taxonomic ID (NCBI) 1773 Genome Sequence (s) GeneBank BX842580.1 EMBL BX842580  Gene Information Gene Name ppiB (Rv2582) NCBI Gene ID 887691 Protein Information Protein Name PpiB UniProtKB/SwissProt ID Q50639 NCBI RefSeq NP_217098.1 EMBL-CDS CAB01261.1 UniProtKB Sequence >sp|Q50639|PPIB_MYCTU Probable peptidyl-prolyl cis-trans isomerase B OS=Mycobacterium tuberculosis GN=ppiB PE=3 SV=1 MGHLTPVAAPRLACAFVPTNAQRRATAKRKLERQLERRAKQAKRRRILTIVGGSLAAVAV IVAVVVTVVVNKDDHQSTTSATPTDSASTSPPQAATAPPLPPFKPSANLGANCQYPPSPD KAVKPVKLPRTGKVPTDPAQVSVSMVTNQGNIGLMLANNESPCTVNSFVSLAQQGFFKGT TCHRLTTSPMLAVLQCGDPKGDGTGGPGYQFANEYPTDQYSANDPKLNEPVIYPRGTLAM ANAGPNTNSSQFFMVYRDSKLPPQYTVFGTIQADGLTTLDKIAKAGVAGGGEDGKPATEV TITSVLLD Sequence length 308 AA Subcellular Location Function Probable peptidyl-prolyl cis-trans isomerase B (EC=5.2.1.8). It may be involved in protein folding. Glycosylation Status Glycosylation Type Information currently not available with us. Technique(s) used for Glycosylation Detection Concanavalin A (ConA) binding Literatures Reference(s) 1) Gonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C. (2009) Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins. J Proteome Res, 8, 721-733. [PubMed: 19196185] Year of Identification 2009