ProGlyProt ID BU209 Organism Information Organism Name Mycobacterium tuberculosis Domain Bacteria Classification Family: Mycobacteriaceae Suborder: Corynebacterineae Order: Actinomycetales Subclass: Actinobacteridae Class: Actinobacteria Division or phylum: "Actinobacteria" Taxonomic ID (NCBI) 1773 Genome Sequence (s) GeneBank BX842581.1 EMBL BX842581 Gene Information Gene Name mpt83 (Rv2873) NCBI Gene ID 887155 Protein Information Protein Name Mpt83 (Cell surface lipoprotein) UniProtKB/SwissProt ID P0A670 NCBI RefSeq NP_217389.1 EMBL-CDS CAA98350.1 UniProtKB Sequence >sp|P0A670|MP83_MYCTU Cell surface lipoprotein MPT83 OS=Mycobacterium tuberculosis GN=mpt83 PE=4 SV=1 MINVQAKPAAAASLAAIAIAFLAGCSSTKPVSQDTSPKPATSPAAPVTTAAMADPAADLI GRGCAQYAAQNPTGPGSVAGMAQDPVATAASNNPMLSTLTSALSGKLNPDVNLVDTLNGG EYTVFAPTNAAFDKLPAATIDQLKTDAKLLSSILTYHVIAGQASPSRIDGTHQTLQGADL TVIGARDDLMVNNAGLVCGGVHTANATVYMIDTVLMPPAQ Sequence length 220 AA Subcellular Location Cell membrane Function Lipoprotein Glycosylation Status Glycosylation Type Information currently not available with us. Technique(s) used for Glycosylation Detection Concanavalin A (ConA) binding Literatures Reference(s) 1) Gonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C. (2009) Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins. J Proteome Res, 8, 721-733. [PubMed: 19196185] 2) Herrmann, J.L., Delahay, R., Gallagher, A., Robertson, B. and Young, D. (2000) Analysis of post-translational modification of mycobacterial proteins using a cassette expression system. FEBS Lett, 473, 358-362. [PubMed: 10818240] Year of Identification 2000