ProGlyProt ID BU208 Organism Information Organism Name Mycobacterium tuberculosis Domain Bacteria Classification Family: Mycobacteriaceae Suborder: Corynebacterineae Order: Actinomycetales Subclass: Actinobacteridae Class: Actinobacteria Division or phylum: "Actinobacteria" Taxonomic ID (NCBI) 1773 Genome Sequence (s) GeneBank BX842576.1 EMBL BX842576 Gene Information Gene Name lprG (Rv1411c) NCBI Gene ID 886700 Protein Information Protein Name LprG UniProtKB/SwissProt ID P0A5I8 NCBI RefSeq NP_215927.1 EMBL-CDS CAB02197.1 UniProtKB Sequence >sp|P0A5I8|LPRG_MYCTU Lipoprotein lprG OS=Mycobacterium tuberculosis GN=lprG PE=1 SV=1 MRTPRRHCRRIAVLAAVSIAATVVAGCSSGSKPSGGPLPDAKPLVEEATAQTKALKSAHM VLTVNGKIPGLSLKTLSGDLTTNPTAATGNVKLTLGGSDIDADFVVFDGILYATLTPNQW SDFGPAADIYDPAQVLNPDTGLANVLANFADAKAEGRDTINGQNTIRISGKVSAQAVNQI APPFNATQPVPATVWIQETGDHQLAQAQLDRGSGNSVQMTLSKWGEKVQVTKPPVS Sequence length 236 AA Subcellular Location Cell membrane Function 27 kDa lipoprotein. It is a TLR-2 ligand that inhibits human macrophage class II MHC antigen processing. Glycosylation Status Glycosylation Type Information currently not available with us. Technique(s) used for Glycosylation Detection Concanavalin A (ConA) binding Literatures Reference(s) 1) Gonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C. (2009) Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins. J Proteome Res, 8, 721-733. [PubMed: 19196185] Year of Identification 2009