ProGlyProt ID BU204 Organism Information Organism Name Mycobacterium tuberculosis Domain Bacteria Classification Family: Mycobacteriaceae Suborder: Corynebacterineae Order: Actinomycetales Subclass: Actinobacteridae Class: Actinobacteria Division or phylum: "Actinobacteria" Taxonomic ID (NCBI) 1773 Genome Sequence (s) GeneBank BX842575.1 EMBL BX842575 Gene Information Gene Name lpqT (Rv1016c) NCBI Gene ID 886066 Protein Information Protein Name LpqT (putative lipoprotein) UniProtKB/SwissProt ID P96384 NCBI RefSeq NP_215532.1 EMBL-CDS CAB06863.1 UniProtKB Sequence >sp|P96384|LPQT_MYCTU Putative lipoprotein lpqT OS=Mycobacterium tuberculosis GN=lpqT PE=4 SV=1 MAGRRCPQDSVRPLAVAVAVATLAMSAVACGPKSPDFQSILSTSPTTSAVSTTTEVPVPL WKYLESVGVTGEPVAPSSLTDLTVSIPTPPGWAPMKNPNITPNTEMIAKGESYPTAMLMV FKLHRDFDIAEALKHGTADARLSTNFTELDSSTADFNGFPSSMIQGSYDLHGRRLHTWNR IVFPTGAPPAKQRYLVQLTITSLANEAVKHASDIEAIIAGFVVAAK Sequence length 226 AA Subcellular Location Cell membrane Function Lipoprotein Glycosylation Status Glycosylation Type Information currently not available with us. Technique(s) used for Glycosylation Detection Concanavalin A (ConA) binding Literatures Reference(s) 1) Gonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C. (2009) Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins. J Proteome Res, 8, 721-733. [PubMed: 19196185] Year of Identification 2009