Search ProCGP (Characterized Glycoproteins) Search ProUGP (Uncharacterized Glycoproteins) Example Display Page Crystal Structures Homology Models Map Sequon Glyseq Extractor Blast Recent Reviews Related Tools & Databases Bibliography ProGlycProt ProGlyProt ID BU196 Organism Information Organism Name Mycobacterium tuberculosis Domain Bacteria Classification Family: Mycobacteriaceae Suborder: Corynebacterineae Order: Actinomycetales Subclass: Actinobacteridae Class: Actinobacteria Division or phylum: "Actinobacteria" Taxonomic ID (NCBI) 1773 Genome Sequence (s) GeneBank BX842579.1 EMBL BX842579 Gene Information Gene Name lppQ (Rv2341) NCBI Gene ID 886275 Protein Information Protein Name LppQ lipoprotein UniProtKB/SwissProt ID P95237 NCBI RefSeq NP_216857.1 EMBL-CDS CAB06158.1 UniProtKB Sequence >tr|P95237|P95237_MYCTU Lipoprotein, putative OS=Mycobacterium tuberculosis GN=lppQ PE=4 SV=1 MPVGGRQHVFEKLASILGLVAAPLMLLGLSACGRSAGKTSEPTCPTEPIDAADSSTTPDP SCVVRATEINGNGSRIQTWTGSYDAAATQSGGVCGGTCNFHATVRFTVDEGQISGSVDQV YQAAMVAIATRPTSPSLAP Sequence length 139 AA Subcellular Location Function Lipoprotein Glycosylation Status Glycosylation Type Information currently not available with us. Technique(s) used for Glycosylation Detection Concanavalin A (ConA) binding Literatures Reference(s) 1) Herrmann, J.L., Delahay, R., Gallagher, A., Robertson, B. and Young, D. (2000) Analysis of post-translational modification of mycobacterial proteins using a cassette expression system. FEBS Lett, 473, 358-362. [PubMed: 10818240] Year of Identification 2000