Search ProCGP (Characterized Glycoproteins) Search ProUGP (Uncharacterized Glycoproteins) Example Display Page Crystal Structures Homology Models Map Sequon Glyseq Extractor Blast Recent Reviews Related Tools & Databases Bibliography ProGlycProt ProGlyProt ID BU185 Organism Information Organism Name Mycobacterium smegmatis Domain Bacteria Classification Family: Mycobacteriaceae Suborder: Corynebacterineae Order: Actinomycetales Subclass: Actinobacteridae Class: Actinobacteria Division or phylum: "Actinobacteria" Taxonomic ID (NCBI) 1772 Genome Sequence (s) GeneBank DQ066883.1 EMBL DQ066883 Gene Information Gene Name hlp NCBI Gene ID 4534852 Protein Information Protein Name Laminin-binding glycoprotein (MS-LBP) or histone-l UniProtKB/SwissProt ID Q4PLR8 NCBI RefSeq YP_886729.1 EMBL-CDS AAY68087.1 UniProtKB Sequence >tr|Q4PLR8|Q4PLR8_MYCSM Histone-like protein OS=Mycobacterium smegmatis GN=hlp PE=3 SV=1 MNKAELIDVLTTKMGTDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVFEQRRRAARVA RNPRTGETVKVKPTSVPAFRPGAQFKAVISGAQKLPADGPAVKRGVTAGPAKKAAKKAPA KKAAAKKTATKAAAKKAPAKKAATKAPAKKAATKAPAKKAATKAPAKKAATKAPAKKAAA KAPAKKAATKAPAKKAAAKKAPAKKGRR Sequence length 208 AA Subcellular Location Function It is involved in laminin-mediated mycobacterial adherence to human pneumocytes and macrophages. Glycosylation Status Glycosylation Type Information currently not available with us. Technique(s) used for Glycosylation Detection MALDI-TOF MS (matrix assisted laser desorption/ionization time of flight mass spectrometry) analysis and gas chromatography-mass spectrometry(GC-MS) Literatures Reference(s) 1) Pethe, K., Puech, V., Daffe, M., Josenhans, C., Drobecq, H., Locht, C. and Menozzi, F.D. (2001) Mycobacterium smegmatis laminin-binding glycoprotein shares epitopes with Mycobacterium tuberculosis heparin-binding haemagglutinin. Mol Microbiol, 39, 89-99. [PubMed: 11123691] Year of Identification 2001