| ProGlyProt ID | BU180 |
| Organism Information |
| Organism Name | Mycobacterium bovis BCG strain 1173P2 |
| Domain | Bacteria |
| Classification | Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria" |
| Taxonomic ID (NCBI) | 410289 |
| Genome Sequence (s) |
| GeneBank | AM408590.1 |
| EMBL | AM408590 |
| Gene Information |
| Gene Name | hbhA (BCG_0516) |
| NCBI Gene ID | 4696475 |
| Protein Information |
| Protein Name | HBHA (heparin-binding hemagglutinin) |
| UniProtKB/SwissProt ID | A1KFU9 |
| NCBI RefSeq | YP_976614.1 |
| EMBL-CDS | CAL70501.1 |
| UniProtKB Sequence | >sp|A1KFU9|HBHA_MYCBP Heparin-binding hemagglutinin OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=hbhA PE=1 SV=1
MAENSNIDDIKAPLLAALGAADLALATVNELITNLRERAEETRTDTRSRVEESRARLTKL
QEDLPEQLTELREKFTAEELRKAAEGYLEAATSRYNELVERGEAALERLRSQQSFEEVSA
RAEGYVDQAVELTQEALGTVASQTRAVGERAAKLVGIELPKKAAPAKKAAPAKKAAPAKK
AAAKKAPAKKAAAKKVTQK |
| Sequence length | 199 AA |
| Subcellular Location | Surface |
| Function | Mycobacterial heparin-binding hemagglutinin (HBHA) functions as an adhesin for epithelial cells and induces bacterial auto-aggregation.Glycosylation of HBHA may protect the protein from proteolytic degradation (crucial for its stabilty), important for HBHA-mediated hemagglutination and for certain immunologic properties of the protein. |
| Glycosylation Status |
| Glycosylation Type | Information currently not available with us. |
| Technique(s) used for Glycosylation Detection | Mass shift detected on SDS-polyacrylamide gel and carbohydrate content determination by GC/ mass spectrophotometry analysis |
| Literatures |
| Reference(s) | 1) Menozzi, F.D., Bischoff, R., Fort, E., Brennan, M.J. and Locht, C. (1998) Molecular characterization of the mycobacterial heparin-binding hemagglutinin, a mycobacterial adhesin. Proc Natl Acad Sci U S A, 95, 12625-12630. [PubMed: 9770536] |
| Year of Identification | 1998 |
