ProGlyProt ID BU169 Organism Information Organism Name Helicobacter (Campylobacter) pylori 1061/J99 Domain Bacteria Classification Family: Helicobacteraceae Order: Campylobacterales Class: Epsilonproteobacteria Division or phylum: "Proteobacteria" Taxonomic ID (NCBI) 85963 Genome Sequence (s) GeneBank AE001439.1 EMBL AE001439 Gene Information Gene Name flaB ( jhp_0107) NCBI Gene ID 889505 Protein Information Protein Name Flagellin B UniProtKB/SwissProt ID Q9ZMV8 NCBI RefSeq NP_222828.1 EMBL-CDS AAD05686.1 UniProtKB Sequence >sp|Q9ZMV8|FLAB_HELPJ Flagellin B OS=Helicobacter pylori J99 GN=flaB PE=3 SV=3 MSFRINTNIAALTSHAVGVQNNRDLSSSLEKLSSGLRINKAADDSSGMAIADSLRSQSAN LGQAIRNANDAIGMVQTADKAMDEQIKILDTIKTKAVQAAQDGQTLESRRALQSDIQRLL EELDNIANTTSFNGQQMLSGSFSNKEFQIGAYSNTTVKASIGSTSSDKIGHVRMETSSFS GEGMLASAAAQNLTEVGLNFKQVNGVNDYKIETVRISTSAGTGIGALSEIINRFSNTLGV RASYNVMATGGTPVQSGTVRELTINGVEIGTVNDVHKNDADGRLTNAINSVKDRTGVEAS LDIQGRINLHSIDGRAISVHAASASGQVFGGGNFAGISGTQHAVIGRLTLTRTDARDIIV SGVNFSHVGFHSAQGVAEYTVNLRAVRGIFDANVASAAGANANGAQAETNSQGIGAGVTS LKGAMIVMDMADSARTQLDKIRSDMGSVQMELVTTINNISVTQVNVKAAESQIRDVDFAE ESANFSKYNILAQSGSFAMAQANAVQQNVLRLLQ Sequence length 514 AA Subcellular Location Secreted Function Flagellin is the subunit protein which polymerizes to form the filaments of bacterial flagella. Important for motility and virulence. Glycosylation Status Glycosylation Type O(Ser/Thr)- linked Technique(s) used for Glycosylation Detection Immunoblotting using antiglycan antiserum. Literatures Reference(s) 1) Schoenhofen, I.C., Lunin, V.V., Julien, J.P., Li, Y., Ajamian, E., Matte, A., Cygler, M., Brisson, J.R., Aubry, A., Logan, S.M. et al. (2006) Structural and functional characterization of PseC, an aminotransferase involved in the biosynthesis of pseudaminic acid, an essential flagellar modification in Helicobacter pylori. J Biol Chem, 281, 8907-8916. [PubMed: 16421095] 2) Schirm, M., Soo, E.C., Aubry, A.J., Austin, J., Thibault, P. and Logan, S.M. (2003) Structural, genetic and functional characterization of the flagellin glycosylation process in Helicobacter pylori. Mol Microbiol, 48, 1579-1592. [PubMed: 12791140] 3) Josenhans, C., Vossebein, L., Friedrich, S. and Suerbaum, S. (2002) The neuA/flmD gene cluster of Helicobacter pylori is involved in flagellar biosynthesis and flagellin glycosylation. FEMS Microbiol Lett, 210, 165-172. [PubMed: 12044670] Year of Identification 2002